Sodium Potassium ATPase Beta 1 Antibody - BSA Free

Western Blot: Sodium Potassium ATPase Beta 1 Antibody [NBP2-95093] - Analysis of extracts of various cell lines, using Sodium Potassium ATPase Beta 1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Beta 1 Antibody [NBP2-95093] - Paraffin-embedded mouse stomach using Sodium Potassium ATPase Beta 1 .

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Beta 1 Antibody [NBP2-95093] - Paraffin-embedded human colon carcinoma using Sodium Potassium ATPase Beta 1 .

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Beta 1 Antibody [NBP2-95093] - Paraffin-embedded human gastric cancer using Sodium Potassium ATPase Beta 1 .

Western Blot: Sodium Potassium ATPase Beta 1 Antibody - BSA Free [Sodium Potassium ATPase Beta 1] - Western blot analysis of various lysates using Sodium Potassium ATPase Beta 1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Beta 1 Antibody - BSA Free [Sodium Potassium ATPase Beta 1] - Immunofluorescence analysis of NIH/3T3 cells using Sodium Potassium ATPase Beta 1 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Beta 1 Antibody - BSA Free [Sodium Potassium ATPase Beta 1] - Immunofluorescence analysis of C6 cells using Sodium Potassium ATPase Beta 1 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sodium Potassium ATPase Beta 1 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 63-303 of human ATP1B1 (NP_001668.1). EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP1B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sodium Potassium ATPase Beta 1 Antibody - BSA Free

• adenosinetriphosphatase
• ATP1B
• ATP1B1
• ATPase, Na+/K+ transporting, beta 1 polypeptide
• Beta 1-subunit of Na(+)
• K(+)-ATPase
• MGC1798
• Na, K-ATPase beta-1 polypeptide
• Sodium Potassium ATPase Beta 1
• sodium/potassium-dependent ATPase beta-1 subunit
• Sodium/potassium-dependent ATPase subunit beta-1
• sodium/potassium-transporting ATPase beta-1 chain
• sodium/potassium-transporting ATPase subunit beta-1

Background

Sodium Potassium ATPase Beta 1 (ATP1B1) is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. Na/K ATPase pumps consist of alpha/beta heterodimers. Beta 1 is the glycosylated, non-catalytic component of the active enzyme responsible for the formation of these alpha/beta heterodimers. Through this assembly, the beta polypeptide regulates the number of sodium pumps transported to the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP1B1