Sodium Potassium ATPase Beta 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Beta 1 Antibody [NBP2-54665] - Staining in human kidney and lymph node tissues using anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same tissues.

Western Blot: Sodium Potassium ATPase Beta 1 Antibody [NBP2-54665] - Analysis in human cell lines Caco-2 and SK-MEL-30 using anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Beta 1 Antibody [NBP2-54665] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Beta 1 Antibody [NBP2-54665] - Staining of human lymph node shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sodium Potassium ATPase Beta 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Sodium Potassium ATPase Beta 1 Antibody - BSA Free (NBP2-54665) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP1B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen (NBP2-54665PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sodium Potassium ATPase Beta 1 Antibody - BSA Free

• adenosinetriphosphatase
• ATP1B
• ATP1B1
• ATPase, Na+/K+ transporting, beta 1 polypeptide
• Beta 1-subunit of Na(+)
• K(+)-ATPase
• MGC1798
• Na, K-ATPase beta-1 polypeptide
• Sodium Potassium ATPase Beta 1
• sodium/potassium-dependent ATPase beta-1 subunit
• Sodium/potassium-dependent ATPase subunit beta-1
• sodium/potassium-transporting ATPase beta-1 chain
• sodium/potassium-transporting ATPase subunit beta-1

Background

Sodium Potassium ATPase Beta 1 (ATP1B1) is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. Na/K ATPase pumps consist of alpha/beta heterodimers. Beta 1 is the glycosylated, non-catalytic component of the active enzyme responsible for the formation of these alpha/beta heterodimers. Through this assembly, the beta polypeptide regulates the number of sodium pumps transported to the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Sodium Potassium ATPase Beta 1 Antibody (NBP2-54665). (Showing 1 - 1 of 1 FAQ).

1. What is the concentration of Sodium Potassium ATPase Beta 1 Antibody (NBP2-54665)?
   • The typical concentration for this product is 0.1 mg/ml. For an exact concentration please contact our Technical Support team with your lot number.

Bioinformatics

• Gene Symbol: ATP1B1