SOCS-2 Antibody (6D3F6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human SOCS-2 (NP_001257400.1). MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
SOCS2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SOCS-2 Antibody (6D3F6)
Background
Accumulating evidence demonstrates that cytokine receptorsignaling is negatively regulated by a family of Srchomology 2 domain-containing adaptor molecules TermedSOCS (Suppressor of Cytokine Signaling). To date, there are eight members of SOCS family have beenrecognized, they are SOCS 1, 2, 3, 4, 5, 6, 7 and CIS. Structurally the SOCS proteins are composed of an Nterminalregion of variable length and amino acidcomposition, a central SH2 domain, and a previouslyunrecognized C-terminal motif that we have called the SOCS box. The SOCS proteins appear to form part of aclassical negative feed back loop that regulates cytokinesignal transduction via a STAT induced transcriptionalmechanism. Transcription of each of the SOCS genesoccurs rapidly in vitro and in vivo in response to cytokines, and once produced, the various members of the SOCSfamily appear to inhibit signaling in different ways. SOCS 2, not like SOCS 1 and SOCS 3, regulates postnatalgrowth, likely through its ability to influence the GH / IGF 1axis, although they might have overlapping actions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Publications for SOCS-2 Antibody (NBP3-16781) (0)
There are no publications for SOCS-2 Antibody (NBP3-16781).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SOCS-2 Antibody (NBP3-16781) (0)
There are no reviews for SOCS-2 Antibody (NBP3-16781).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SOCS-2 Antibody (NBP3-16781) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SOCS-2 Products
Research Areas for SOCS-2 Antibody (NBP3-16781)
Find related products by research area.
|
Blogs on SOCS-2