SNX8 Antibody

Images

 
Western Blot: SNX8 Antibody [NBP2-31672] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-2 OS
Immunocytochemistry/ Immunofluorescence: SNX8 Antibody [NBP2-31672] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: SNX8 Antibody [NBP2-31672] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EKGVLHKHQRALHKYSLMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVNSQIQGHKEMSKVWNDLRPKLSCLFAGPHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNX8 Protein (NBP2-31672PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX8 Antibody

  • DKFZp761E1721
  • Mvp1
  • sorting nexin 8
  • sorting nexin-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NB100-109
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1725
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-30894
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SNX8 Antibody (NBP2-31672) (0)

There are no publications for SNX8 Antibody (NBP2-31672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX8 Antibody (NBP2-31672) (0)

There are no reviews for SNX8 Antibody (NBP2-31672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNX8 Antibody (NBP2-31672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX8 Products

Bioinformatics Tool for SNX8 Antibody (NBP2-31672)

Discover related pathways, diseases and genes to SNX8 Antibody (NBP2-31672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX8 Antibody (NBP2-31672)

Discover more about diseases related to SNX8 Antibody (NBP2-31672).
 

Pathways for SNX8 Antibody (NBP2-31672)

View related products by pathway.

Research Areas for SNX8 Antibody (NBP2-31672)

Find related products by research area.

Blogs on SNX8

There are no specific blogs for SNX8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX8
Uniprot