FTSJ2 Antibody

Images

 
Western Blot: FTSJ2 Antibody [NBP2-30894] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: FTSJ2 Antibody [NBP2-30894] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FTSJ2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FTSJ2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FTSJ2 Protein (NBP2-30894PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FTSJ2 Antibody

  • DKFZp686J14194
  • EC 2.1.1.-
  • FJH1cell division protein FtsJ
  • FtsJ homolog 2 (E. coli)
  • Protein ftsJ homolog 2
  • putative ribosomal RNA methyltransferase 2
  • rRNA (uridine-2'-O-)-methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-109
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82774
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-83845
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85703
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-03367
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for FTSJ2 Antibody (NBP2-30894) (0)

There are no publications for FTSJ2 Antibody (NBP2-30894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTSJ2 Antibody (NBP2-30894) (0)

There are no reviews for FTSJ2 Antibody (NBP2-30894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FTSJ2 Antibody (NBP2-30894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FTSJ2 Products

Bioinformatics Tool for FTSJ2 Antibody (NBP2-30894)

Discover related pathways, diseases and genes to FTSJ2 Antibody (NBP2-30894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FTSJ2 Antibody (NBP2-30894)

Discover more about diseases related to FTSJ2 Antibody (NBP2-30894).
 

Pathways for FTSJ2 Antibody (NBP2-30894)

View related products by pathway.

Blogs on FTSJ2

There are no specific blogs for FTSJ2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FTSJ2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FTSJ2
Uniprot