SNX19 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SNX19 Antibody [NBP1-84491] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: SNX19 Antibody [NBP1-84491] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RVEARKSLLESFLKQLCAIPEIANSEEVQEFLALNTDARIAFVKKPFMVSRIDKMVVSAIVDTLKTAFPRSEPQSPTEELSEAETESKPQTEGKKASKSRLRFSSSKISPALSVTEAQDKILYCLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNX19 Protein (NBP1-84491PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX19 Antibody

  • DKFZp667I205
  • KIAA0254CHET8
  • sorting nexin 19
  • sorting nexin-19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB7906
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
355-BM/CF
Species: Hu, Mu, Rt
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20443
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
MAB7475
Species: Hu, Rt
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP

Publications for SNX19 Antibody (NBP1-84491) (0)

There are no publications for SNX19 Antibody (NBP1-84491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX19 Antibody (NBP1-84491) (0)

There are no reviews for SNX19 Antibody (NBP1-84491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SNX19 Antibody (NBP1-84491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX19 Products

Bioinformatics Tool for SNX19 Antibody (NBP1-84491)

Discover related pathways, diseases and genes to SNX19 Antibody (NBP1-84491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX19 Antibody (NBP1-84491)

Discover more about diseases related to SNX19 Antibody (NBP1-84491).
 

Pathways for SNX19 Antibody (NBP1-84491)

View related products by pathway.

PTMs for SNX19 Antibody (NBP1-84491)

Learn more about PTMs related to SNX19 Antibody (NBP1-84491).
 

Research Areas for SNX19 Antibody (NBP1-84491)

Find related products by research area.

Blogs on SNX19

There are no specific blogs for SNX19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX19