SNRPD2 Antibody - BSA Free

Western Blot: SNRPD2 Antibody [NBP1-57173] - Human 293T, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in HEK293T.

Western Blot: SNRPD2 Antibody [NBP1-57173] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Western Blot: SNRPD2 Antibody [NBP1-57173] - Human MCF7, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in MCF7.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SNRPD2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SNRPD2(small nuclear ribonucleoprotein D2 polypeptide 16.5kDa) The peptide sequence was selected from the N terminal of SNRPD2. Peptide sequence MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNRPD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SNRPD2 Antibody - BSA Free

• small nuclear ribonucleoprotein D2 polypeptide (16.5kD)
• small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
• small nuclear ribonucleoprotein Sm D2
• Sm-D2SMD2
• snRNP core protein D2
• SNRPD1

Background

SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRPD2
• Uniprot:
  • P62316(Human)