![Western Blot: SNRPD1 Antibody [NBP2-83569] - Host: Rabbit. Target Name: SNRPD1. Sample Tissue: Human HepG2. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/SNRPD1-Antibody-Western-Blot-NBP2-83569-img0003.jpg "Western Blot: SNRPD1 Antibody [NBP2-83569] - Host: Rabbit. Target Name: SNRPD1. Sample Tissue: Human HepG2. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit SNRPD1 Antibody - BSA Free (NBP2-83569) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human SNRPD1. Peptide sequence: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SNRPD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SNRPD1 Antibody (NBP2-83569)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SNRPD1 |
![Immunohistochemistry-Paraffin: SNRPD1 Antibody [NBP2-83569] - Rabbit Anti-SNRPD1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Tonsil. Primary antibody Concentration: 1:200. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec](http://images.novusbio.com/fullsize/SNRPD1-Antibody-Immunohistochemistry-Paraffin-NBP2-83569-img0002.jpg "Immunohistochemistry-Paraffin: SNRPD1 Antibody [NBP2-83569] - Rabbit Anti-SNRPD1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Tonsil. Primary antibody Concentration: 1:200. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec")
![Western Blot: SNRPD1 Antibody [NBP2-83569] - Host: Rabbit. Target: SNRPD1. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): Human Stomach Tumor (T-ST). Antibody concentration: 1ug/ml](http://images.novusbio.com/fullsize/SNRPD1-Antibody-Western-Blot-NBP2-83569-img0004.jpg "Western Blot: SNRPD1 Antibody [NBP2-83569] - Host: Rabbit. Target: SNRPD1. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): Human Stomach Tumor (T-ST). Antibody concentration: 1ug/ml")
![Immunohistochemistry-Paraffin: SNRPD1 Antibody [NBP2-83569] - Rabbit Anti-SNRPD1 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X](http://images.novusbio.com/fullsize/SNRPD1-Antibody-Immunohistochemistry-Paraffin-NBP2-83569-img0001.jpg "Immunohistochemistry-Paraffin: SNRPD1 Antibody [NBP2-83569] - Rabbit Anti-SNRPD1 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X")
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
