![Western Blot: SNRPA1 Antibody [H00006627-B01P] - Analysis of SNRPA1 expression in human liver.](http://images.novusbio.com/fullsize/SNRPA1-Antibody-Western-Blot-H00006627-B01P-img0003.jpg "Western Blot: SNRPA1 Antibody [H00006627-B01P] - Analysis of SNRPA1 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | SNRPA1 (NP_003081, 1 a.a. - 255 a.a.) full-length human protein. MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS |
| Specificity | SNRPA1, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SNRPA1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SNRPA1 Antibody (H00006627-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: SNRPA1 Antibody [H00006627-B01P] - Analysis of SNRPA1 expression in transfected 293T cell line by SNRPA1 polyclonal antibody. Lane 1: SNRPA1 transfected lysate(28.05 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SNRPA1-Antibody-Western-Blot-H00006627-B01P-img0004.jpg "Western Blot: SNRPA1 Antibody [H00006627-B01P] - Analysis of SNRPA1 expression in transfected 293T cell line by SNRPA1 polyclonal antibody. Lane 1: SNRPA1 transfected lysate(28.05 KDa). Lane 2: Non-transfected lysate.")
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RI_AF3025_Western_Blot_17081.jpg)
![Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RI_AF3025_Immunocytochemistry_9948.jpg)
![Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]](https://images.novusbio.com/images/af3025_human-tgf-beta-ri-alk-5-affinity-purified-polyclonal-ab-41202412402510.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")