SNRPA1 Antibody

Images

 
Western Blot: SNRPA1 Antibody [H00006627-B01P] - Analysis of SNRPA1 expression in human liver.
Western Blot: SNRPA1 Antibody [H00006627-B01P] - Analysis of SNRPA1 expression in transfected 293T cell line by SNRPA1 polyclonal antibody. Lane 1: SNRPA1 transfected lysate(28.05 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SNRPA1 Antibody Summary

Immunogen
SNRPA1 (NP_003081, 1 a.a. - 255 a.a.) full-length human protein. MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS
Specificity
SNRPA1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SNRPA1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNRPA1 Antibody

  • Lea1
  • small nuclear ribonucleoprotein polypeptide A'
  • U2 small nuclear ribonucleoprotein A'
  • U2 small nuclear ribonucleoprotein polypeptide A'
  • U2 snRNP A'

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45893
Species: Hu
Applications: WB, IHC
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80690
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57100
Species: Hu
Applications: ICC/IF
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
AF3025
Species: Hu
Applications: WB, ICC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-83324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00005239-B01P
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NBP1-91755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006627-B01P
Species: Hu
Applications: WB

Publications for SNRPA1 Antibody (H00006627-B01P) (0)

There are no publications for SNRPA1 Antibody (H00006627-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRPA1 Antibody (H00006627-B01P) (0)

There are no reviews for SNRPA1 Antibody (H00006627-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNRPA1 Antibody (H00006627-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNRPA1 Products

Bioinformatics Tool for SNRPA1 Antibody (H00006627-B01P)

Discover related pathways, diseases and genes to SNRPA1 Antibody (H00006627-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRPA1 Antibody (H00006627-B01P)

Discover more about diseases related to SNRPA1 Antibody (H00006627-B01P).

Research Areas for SNRPA1 Antibody (H00006627-B01P)

Find related products by research area.

Blogs on SNRPA1

There are no specific blogs for SNRPA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRPA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRPA1
Entrez
Uniprot