Home » CPSF73 » CPSF73 Antibodies » CPSF73 Antibody (6E6)

CPSF73 Antibody (6E6)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in NIH/3T3.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: CPSF73 Antibody (6E6) [H00051692-M01] - Analysis of monoclonal antibody to CPSF3 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in PC-12.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6 Analysis of CPSF3 expression in Hela S3 NE.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in Raw 264.7.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - Analysis of CPSF3 expression in transfected 293T cell line by CPSF3 monoclonal antibody (M01), clone 6E6.Lane 1: CPSF3 transfected lysate(77.5 KDa).Lane 2: ...read more
ELISA: CPSF73 Antibody (6E6) [H00051692-M01] - Detection limit for recombinant GST tagged CPSF3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CPSF73 Antibody (6E6) Summary

Immunogen
CPSF3 (NP_057291, 585 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH
Specificity
CPSF3 - cleavage and polyadenylation specific factor 3, 73kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CPSF3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPSF73 Antibody (6E6)

  • cleavage and polyadenylation specific factor 3, 73kD subunit
  • cleavage and polyadenylation specific factor 3, 73kDa
  • cleavage and polyadenylation specificity factor 3
  • Cleavage and polyadenylation specificity factor 73 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 3
  • CPSF 73 kDa subunit
  • CPSF3
  • CPSF73
  • CPSF-73
  • CPSF73CPSF
  • EC 3.1.27
  • EC 3.1.27.-
  • mRNA 3'-end-processing endonuclease CPSF-73
  • YSH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNM1 Antibody
NBP1-89663
Immunohistochemistry-Paraffin: SNM1 Antibody [NBP1-89663] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunocytochemistry: SNM1 Antibody [NBP1-89663] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Symplekin Antibody
(4C2)
H00008189-M03
Western Blot: Symplekin Antibody (4C2) [H00008189-M03] - SYMPK expression in COLO 320 HSR ( Cat # L020V1 ).
ELISA: Symplekin Antibody (4C2) [H00008189-M03] - Detection limit for recombinant GST tagged SYMPK is approximately 0.03ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Symplekin Antibody (4C2) [H00008189-M03] - Analysis of monoclonal antibody to SYMPK on HeLa cell. Antibody concentration 10 ug/ml
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Artemis Antibody -
BSA Free
NB100-183
Western Blot: Artemis Antibody [NB100-183] - Detection of Artemis protein in human testis lysate using NB 100-183.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB
FLASH Antibody -
BSA Free
NB500-218
Western Blot: FLASH Antibody [NB500-218] - Analysis of FLASH in NIH3T3 cells using this antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB
CPSF2 Antibody
NBP1-82910
Immunohistochemistry-Paraffin: CPSF2 Antibody [NBP1-82910] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
Western Blot: CPSF2 Antibody [NBP1-82910] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: CPSF2 Antibody [NBP1-82910] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
INTS11 Antibody
NB100-60638
Immunoprecipitation: INTS11 Antibody [NB100-60638] - Detection of human INT11 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-INT11 antibody NB100-60638 (lot NB100-60638-3) used for IP at 6 ug per reaction. INT11 was also immunoprecipitated by a previous lot of this antibody (lot NB100-60638) and another rabbit anti-INT11 antibody. For blotting immunoprecipitated INT11, NB100-60638 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: INTS11 Antibody [NB100-60638] - Whole cell lysate (50 ug) from HeLa, K-562, A-549, TCMK-1, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-INT11antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with anexposure time of 3 minutes.
Immunohistochemistry-Paraffin: INTS11 Antibody [NB100-60638] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-INT11 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
(1 Review)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
LSM11 Antibody
NBP1-81938
Immunohistochemistry-Paraffin: LSM11 Antibody [NBP1-81938] - Staining of human stomach shows strong cytoplasmic and weak nuclear positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: LSM11 Antibody [NBP1-81938] - Staining of human cell line U-2 OS shows localization to nucleus.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ELAC2 Antibody
NBP1-84620
Immunocytochemistry/Immunofluorescence: ELAC2 Antibody [NBP1-84620] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
SUMO2 Antibody
(SUMO2/1199) - Azide ...
NBP2-47710
Immunohistochemistry-Paraffin: SUMO2 Antibody (SUMO2/1199) - Azide and BSA Free [NBP2-47710] - Human Tonsil stained with SUMO-2 Monoclonal Antibody (SUMO2/1199)
Immunohistochemistry-Paraffin: SUMO2 Antibody (SUMO2/1199) - Azide and BSA Free [NBP2-47710] - Rat Heart stained with SUMO-2 Monoclonal Antibody (SUMO2/1199)
Immunohistochemistry-Paraffin: SUMO2 Antibody (SUMO2/1199) - Azide and BSA Free [NBP2-47710] - Rat Ovary stained with SUMO-2 Monoclonal Antibody (SUMO2/1199)
Species: Hu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P
53BP1 Antibody -
BSA Free
NB100-304
Western Blot: 53BP1 Antibody [NB100-304] - Total protein from HeLa, A431, Neuro2A, and PC12 was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL in 5% block buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence. The observed molecular weight for these samples are ~250 kDa and the theoretical molecular weight is 214 kDa.
Knockout Validated: 53BP1 Antibody [NB100-304] - 53BP1 was detected in immersion fixed HeLa cells (left) but was not detected in 53BP1 knockout Hela cells (right) using Rabbit Anti-human 53BP1 polyclonal antibody (Catalog #NB100-304) at 0.3 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei.
Immunocytochemistry/Immunofluorescence: 53BP1 Antibody [NB100-304] - Human medulloblastoma (DAOY) and mouse astrocyte (C8D1A) cell lines were exposed for 48 hours to DMSO or 1ug/mL of the DNA damaging agent EPE. Cells were immunostained for 53BP1 (green). The nuclei were counterstained with DAPI (blue). Image from verified customer review.
(14 Reviews)
(570 Publications)
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
IRF1 Antibody
(SR44-08)
NBP2-67330
Flow Cytometry: IRF1 Antibody (SR44-08) [NBP2-67330] - Analysis of Jurkat cells with IRF1 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: IRF1 Antibody (SR44-08) [NBP2-67330] - Staining IRF1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: IRF1 Antibody (SR44-08) [NBP2-67330] - Staining IRF1 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
RFXANK Antibody
(OTI3E7)
NBP2-01756
Flow Cytometry: RFXANK Antibody (OTI3E7) [NBP2-01756] - Analysis of Jurkat cells, using anti-RFXANK antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Western Blot: RFXANK Antibody (OTI3E7) [NBP2-01756] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFXANK (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RFXANK.
Immunohistochemistry-Paraffin: RFXANK Antibody (OTI3E7) [NBP2-01756] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-RFXANK mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SCARA3 Antibody
(3A2)
H00051435-M01
ELISA: SCARA3 Antibody (3A2) [H00051435-M01] - Detection limit for recombinant GST tagged SCARA3 is approximately 3ng/ml as a capture antibody.
Western Blot: SCARA3 Antibody (3A2) [H00051435-M01] - SCARA3 monoclonal antibody (M01), clone 3A2. Analysis of SCARA3 expression in PC-12.
Western Blot: SCARA3 Antibody (3A2) [H00051435-M01] - SCARA3 monoclonal antibody (M01), clone 3A2. Analysis of SCARA3 expression in HepG2.
Species: Hu, Mu, Rt
Applications: ELISA, WB
RNPC3 Antibody
NBP2-93867
Western Blot: RNPC3 Antibody [NBP2-93867] - Analysis of extracts of various cell lines, using RNPC3 . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: WB
LSM3 Antibody
NBP2-14206
Immunocytochemistry/Immunofluorescence: LSM3 Antibody [NBP2-14206] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LSM3 Antibody [NBP2-14206] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MBL Antibody
AF2307
MBL Antibody
(3 Reviews)
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
SLBP Antibody
(2C4-1C8)
H00007884-M01
Western Blot: SLBP Antibody (2C4-1C8) [H00007884-M01] - SLBP monoclonal antibody (M01), clone 2C4-1C8 Analysis of SLBP expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: SLBP Antibody (2C4-1C8) [H00007884-M01] - Analysis of monoclonal antibody to SLBP on HeLa cell. Antibody concentration 10 ug/ml.
(4 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB

Publications for CPSF73 Antibody (H00051692-M01) (0)

There are no publications for CPSF73 Antibody (H00051692-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPSF73 Antibody (H00051692-M01) (0)

There are no reviews for CPSF73 Antibody (H00051692-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CPSF73 Antibody (H00051692-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPSF73 Products

Bioinformatics Tool for CPSF73 Antibody (H00051692-M01)

Discover related pathways, diseases and genes to CPSF73 Antibody (H00051692-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPSF73 Antibody (H00051692-M01)

Discover more about diseases related to CPSF73 Antibody (H00051692-M01).
 

Pathways for CPSF73 Antibody (H00051692-M01)

View related products by pathway.

PTMs for CPSF73 Antibody (H00051692-M01)

Learn more about PTMs related to CPSF73 Antibody (H00051692-M01).

Blogs on CPSF73

There are no specific blogs for CPSF73, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPSF73 Antibody (6E6) and receive a gift card or discount.


Bioinformatics

Gene Symbol CPSF3
Entrez
OMIM
Uniprot