CPSF73 Antibody (6E6)

Images

 
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: CPSF73 Antibody (6E6) [H00051692-M01] - Analysis of monoclonal antibody to CPSF3 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in PC-12.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6 Analysis of CPSF3 expression in Hela S3 NE.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - CPSF3 monoclonal antibody (M01), clone 6E6. Analysis of CPSF3 expression in Raw 264.7.
Western Blot: CPSF73 Antibody (6E6) [H00051692-M01] - Analysis of CPSF3 expression in transfected 293T cell line by CPSF3 monoclonal antibody (M01), clone 6E6.Lane 1: CPSF3 transfected lysate(77.5 KDa).Lane 2: ...read more
ELISA: CPSF73 Antibody (6E6) [H00051692-M01] - Detection limit for recombinant GST tagged CPSF3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CPSF73 Antibody (6E6) Summary

Immunogen
CPSF3 (NP_057291, 585 a.a. ~ 685 a.a) partial recombinant protein with GST tag. LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH
Specificity
CPSF3 - cleavage and polyadenylation specific factor 3, 73kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CPSF3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPSF73 Antibody (6E6)

  • cleavage and polyadenylation specific factor 3, 73kD subunit
  • cleavage and polyadenylation specific factor 3, 73kDa
  • cleavage and polyadenylation specificity factor 3
  • Cleavage and polyadenylation specificity factor 73 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 3
  • CPSF 73 kDa subunit
  • CPSF-73
  • CPSF73CPSF
  • EC 3.1.27
  • EC 3.1.27.-
  • mRNA 3'-end-processing endonuclease CPSF-73
  • YSH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89663
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB100-74592
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-183
Species: Hu
Applications: WB
NB500-218
Species: Hu, Mu
Applications: WB
NB100-79823
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NB100-60638
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81938
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
AF4715
Species: Mu
Applications: WB
NBP2-01756
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13286
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-14206
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
H00007884-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CPSF73 Antibody (H00051692-M01) (0)

There are no publications for CPSF73 Antibody (H00051692-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPSF73 Antibody (H00051692-M01) (0)

There are no reviews for CPSF73 Antibody (H00051692-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CPSF73 Antibody (H00051692-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPSF73 Products

Bioinformatics Tool for CPSF73 Antibody (H00051692-M01)

Discover related pathways, diseases and genes to CPSF73 Antibody (H00051692-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPSF73 Antibody (H00051692-M01)

Discover more about diseases related to CPSF73 Antibody (H00051692-M01).
 

Pathways for CPSF73 Antibody (H00051692-M01)

View related products by pathway.

PTMs for CPSF73 Antibody (H00051692-M01)

Learn more about PTMs related to CPSF73 Antibody (H00051692-M01).

Blogs on CPSF73

There are no specific blogs for CPSF73, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPSF73 Antibody (6E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CPSF3
Entrez
OMIM
Uniprot