SNF5 Antibody (9A9G0)

Western Blot: SNF5 Antibody (6X6T8) [NBP3-16159] - Western blot analysis of extracts of 293T cells, using SMARCB1/SNF5 antibody (NBP3-16159) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: SNF5 Antibody (9A9G0) [NBP3-16159] - Western blot analysis of various lysates, using SNF5 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:2000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunoprecipitation: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunoprecipitation of from 300 ug extracts of 293F cells was performed using 3 ug of [KO Validated] SNF5 Rabbit mAb . Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] SNF5 Rabbit mAb at a dilution of 1:12000.

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Rat lung using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Human undifferentiated carcinoma of esophagus using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: SNF5 Antibody (9A9G0) [NBP3-16159] - Immunohistochemistry analysis of paraffin-embedded Human epithelioid sarcoma (ini-1 deletion) using [KO Validated] SNF5 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KO
• Clone: 9A9G0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SNF5 Antibody (9A9G0) Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit SNF5 Antibody (9A9G0) (NBP3-16159) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SNF5 (NP_003064.2). LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SMARCB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SNF5 Antibody (9A9G0)

• BAF47
• BAF47hSNF5
• BRG1-associated factor 47
• hSNFS
• Ini1
• INI1RTPS1
• Integrase interactor 1 protein
• malignant rhabdoid tumor suppressor
• RDTSNF5 homolog
• Sfh1p
• SNF5
• SNF5L1
• Snr1
• subfamily b, member 1
• sucrose nonfermenting, yeast, homolog-like 1
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1

Background

SNF5 is encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCB1