SNF1LK2/SIK2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SNF1LK2/SIK2 Antibody [NBP1-85114] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SNF1LK2/SIK2 Antibody [NBP1-85114] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNF1LK2/SIK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDTPKVNGCLLDPVPPVLVRKGCQSLPSNMMETSIDEGLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNF1LK2/SIK2 Protein (NBP1-85114PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNF1LK2/SIK2 Antibody

  • DKFZp434K1115
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0781SIK-2
  • LOH11CR1I
  • QIK
  • QIKSNF1LK2
  • Qin-induced kinase
  • salt-inducible kinase 2
  • Salt-inducible protein kinase 2
  • salt-inducible serine/threonine kinase 2
  • serine/threonine-protein kinase SIK2
  • Serine/threonine-protein kinase SNF1-like kinase 2
  • SIK2
  • SNF1-like kinase 2
  • SNF1LK2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
AF5599
Species: Mu
Applications: WB, IHC
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-85114
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SNF1LK2/SIK2 Antibody (NBP1-85114) (0)

There are no publications for SNF1LK2/SIK2 Antibody (NBP1-85114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNF1LK2/SIK2 Antibody (NBP1-85114) (0)

There are no reviews for SNF1LK2/SIK2 Antibody (NBP1-85114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SNF1LK2/SIK2 Antibody (NBP1-85114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNF1LK2/SIK2 Products

Bioinformatics Tool for SNF1LK2/SIK2 Antibody (NBP1-85114)

Discover related pathways, diseases and genes to SNF1LK2/SIK2 Antibody (NBP1-85114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNF1LK2/SIK2 Antibody (NBP1-85114)

Discover more about diseases related to SNF1LK2/SIK2 Antibody (NBP1-85114).
 

Pathways for SNF1LK2/SIK2 Antibody (NBP1-85114)

View related products by pathway.

PTMs for SNF1LK2/SIK2 Antibody (NBP1-85114)

Learn more about PTMs related to SNF1LK2/SIK2 Antibody (NBP1-85114).
 

Research Areas for SNF1LK2/SIK2 Antibody (NBP1-85114)

Find related products by research area.

Blogs on SNF1LK2/SIK2

There are no specific blogs for SNF1LK2/SIK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNF1LK2/SIK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIK2
Entrez