SMOX Antibody


Western Blot: SMOX Antibody [NBP2-55775] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SMOX Antibody [NBP2-55775] - Staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & vesicles. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

SMOX Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFMRVVE
Specificity of human SMOX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMOX Recombinant Protein Antigen (NBP2-55775PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SMOX Antibody

  • C20orf16
  • chromosome 20 open reading frame 16
  • EC
  • flavin containing amine oxidase
  • flavin-containing spermine oxidase
  • FLJ20746
  • MGC1010
  • PAO
  • PAO-1
  • PAOH1
  • Polyamine oxidase 1
  • putative cyclin G1 interacting protein
  • SMOdJ779E11.1
  • spermine oxidase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ca, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, IP, RNAi
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SMOX Antibody (NBP2-55775) (0)

There are no publications for SMOX Antibody (NBP2-55775).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMOX Antibody (NBP2-55775) (0)

There are no reviews for SMOX Antibody (NBP2-55775). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMOX Antibody (NBP2-55775) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SMOX Antibody (NBP2-55775)

Discover related pathways, diseases and genes to SMOX Antibody (NBP2-55775). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMOX Antibody (NBP2-55775)

Discover more about diseases related to SMOX Antibody (NBP2-55775).

Pathways for SMOX Antibody (NBP2-55775)

View related products by pathway.

PTMs for SMOX Antibody (NBP2-55775)

Learn more about PTMs related to SMOX Antibody (NBP2-55775).

Blogs on SMOX

There are no specific blogs for SMOX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SMOX Antibody and receive a gift card or discount.


Gene Symbol SMOX