We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Smoothened GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Smoothened GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 653-787 of Human Smoothened

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
40.37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Smoothened GST (N-Term) Protein

  • bnb
  • CRJS
  • FZD11
  • Gx
  • Protein Gx
  • SMO
  • SMOH
  • SMOHseven transmembrane helix receptor
  • smoothened (Drosophila) homolog
  • smoothened homolog (Drosophila)
  • smoothened homolog
  • Smoothened

Background

Smoothened, a Frizzled Receptor, is homologous to the Drosophila segment polarity Smo gene. It associates with the Patched protein to mediate the cellular response to the Hedgehog secreted protein signal, which controls patterning and growth during vertebrate development. Smoothened is activated in a number of human tumors and can function as an oncogene in basal-cell carcinomas. Smoothened expression has been documented in bladder, blood, brain, the central nervous system, skin, and ureter. ESTs have been isolated from amnion, bone, brain, breast, embryo, eye, heart, nerve, and skin libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB41051
Species: Hu, Mu
Applications: WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
AF482
Species: Mu
Applications: IHC, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-33711
Species: Hu
Applications: IHC,  IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1705
Species: Mu
Applications: IHC, WB
AF3635
Species: Mu
Applications: IHC, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
NBP1-87384
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1568
Species: Mu
Applications: WB
NBP3-45791
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF196
Species: Mu
Applications: IHC, WB

Publications for Smoothened Partial Recombinant Protein (H00006608-Q02) (0)

There are no publications for Smoothened Partial Recombinant Protein (H00006608-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smoothened Partial Recombinant Protein (H00006608-Q02) (0)

There are no reviews for Smoothened Partial Recombinant Protein (H00006608-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smoothened Partial Recombinant Protein (H00006608-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Smoothened Products

Research Areas for Smoothened Partial Recombinant Protein (H00006608-Q02)

Find related products by research area.

Blogs on Smoothened.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Pancreatic Cancer Research Targets Hedgehog Signaling Pathway
The Hedgehog Signaling Pathway (HSP) is an important pathway involved in embryonic development by regulating cell differentiation. This pathway has also become an increasingly hot topic in cancer research in recent years. The HSP involves the interact...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Smoothened GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMO