SMCP Antibody

Images

 
Western Blot: SMCP Antibody [NBP1-81252] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: SMCP Antibody [NBP1-81252] - Staining of human cell line U-251MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SMCP Antibody [NBP1-81252] - Staining of human testis shows strong cytoplasmic positivity in spermatids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

SMCP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMCP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
SMCP Protein (NBP1-81252PEP)
Publications
Read Publication using NBP1-81252.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Alternate Names for SMCP Antibody

  • HSMCSGEN1
  • MCSMGC26305
  • MCSPMGC26519
  • mitochondrial capsule selenoprotein
  • sperm mitochondria-associated cysteine-rich protein
  • sperm mitochondrial-associated cysteine-rich protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
AF5539
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90927
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49579
Species: Hu
Applications: IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-92290
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SMCP Antibody (NBP1-81252)(1)

Reviews for SMCP Antibody (NBP1-81252) (0)

There are no reviews for SMCP Antibody (NBP1-81252). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMCP Antibody (NBP1-81252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMCP Antibody Products

Related Products by Gene

Bioinformatics Tool for SMCP Antibody (NBP1-81252)

Discover related pathways, diseases and genes to SMCP Antibody (NBP1-81252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMCP Antibody (NBP1-81252)

Discover more about diseases related to SMCP Antibody (NBP1-81252).
 

Pathways for SMCP Antibody (NBP1-81252)

View related products by pathway.

PTMs for SMCP Antibody (NBP1-81252)

Learn more about PTMs related to SMCP Antibody (NBP1-81252).

Blogs on SMCP

There are no specific blogs for SMCP, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SMCP

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81252 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought