SMCP Antibody - BSA Free

Western Blot: SMCP Antibody [NBP1-81252] - Analysis in control (vector only transfected HEK293T lysate) and SMCP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SMCP Antibody [NBP1-81252] - Staining of human testis shows strong cytoplasmic positivity in spermatids.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMCP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SMCP Antibody - BSA Free (NBP1-81252) is a polyclonal antibody validated for use in IHC and WB. Anti-SMCP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMCP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SMCP Protein (NBP1-81252PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMCP Antibody - BSA Free

• HSMCSGEN1
• MCSMGC26305
• MCSPMGC26519
• mitochondrial capsule selenoprotein
• sperm mitochondria-associated cysteine-rich protein
• sperm mitochondrial-associated cysteine-rich protein

Background

Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated,flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. Theprotein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thoughtto function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMCP Antibody (NBP1-81252)(2)

Publications using NBP1-81252

• Wang S, Wang H, Jin B et al. scRNA-seq and scATAC-seq reveal that Sertoli cell mediates spermatogenesis disorders through stage-specific communications in non-obstructive azoospermia eLife 2025-05-15 [PMID: 40371706]
• Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014-06-01 [PMID: 24598113]

Bioinformatics

• Gene Symbol: SMCP