SMCP Antibody

Images

 
Western Blot: SMCP Antibody [NBP1-81252] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: SMCP Antibody [NBP1-81252] - Staining of human cell line U-251MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SMCP Antibody [NBP1-81252] - Staining of human testis shows strong cytoplasmic positivity in spermatids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

SMCP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMCP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
SMCP Protein (NBP1-81252PEP)
Publications
Read Publication using NBP1-81252.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Alternate Names for SMCP Antibody

  • HSMCSGEN1
  • MCSMGC26305
  • MCSPMGC26519
  • mitochondrial capsule selenoprotein
  • sperm mitochondria-associated cysteine-rich protein
  • sperm mitochondrial-associated cysteine-rich protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
AF5539
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90927
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49579
Species: Hu
Applications: IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-92290
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SMCP Antibody (NBP1-81252)(1)

Reviews for SMCP Antibody (NBP1-81252) (0)

There are no reviews for SMCP Antibody (NBP1-81252). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMCP Antibody (NBP1-81252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMCP Antibody Products

Related Products by Gene

Bioinformatics Tool for SMCP Antibody (NBP1-81252)

Discover related pathways, diseases and genes to SMCP Antibody (NBP1-81252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMCP Antibody (NBP1-81252)

Discover more about diseases related to SMCP Antibody (NBP1-81252).
 

Pathways for SMCP Antibody (NBP1-81252)

View related products by pathway.

PTMs for SMCP Antibody (NBP1-81252)

Learn more about PTMs related to SMCP Antibody (NBP1-81252).

Blogs on SMCP

There are no specific blogs for SMCP, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our SMCP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMCP

Customers Who Bought This Also Bought