SMC6L1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit SMC6L1 Antibody - BSA Free (NBP3-09426) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SMC6L1 (NP_078900). Peptide sequence MADSQRFRQFILLTPQSMSSLPSSKLIRILRMSDPERGQTTLPFRPVTQE |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SMC6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
126 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SMC6L1 Antibody - BSA Free
Background
SMC (Structural maintenance of chromosomes) proteins are members of multisubunit complexes that play a critical role in chromosome organization, segregation, gene regulation, and DNA repair. Two of these complexes, cohesin and condensin consist of a core complex of an SMC1 and SMC3 heterodimer or an SMC2 and SMC4 heterodimer, respectively. A third complex includes a heterodimer of SMC5 and SMC6 whose function is not fully understood but is proposed to be related to DNA repair.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for SMC6L1 Antibody (NBP3-09426) (0)
There are no publications for SMC6L1 Antibody (NBP3-09426).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SMC6L1 Antibody (NBP3-09426) (0)
There are no reviews for SMC6L1 Antibody (NBP3-09426).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SMC6L1 Antibody (NBP3-09426) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SMC6L1 Products
Research Areas for SMC6L1 Antibody (NBP3-09426)
Find related products by research area.
|
Blogs on SMC6L1