DYM Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DYM Antibody [NBP2-13942] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: DYM Antibody [NBP2-13942] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DYM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVL EQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DYM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DYM Protein (NBP2-13942PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DYM Antibody

  • DMCSMCFLJ20071
  • Dyggve-Melchior-Clausen syndrome protein
  • dymeclin
  • FLJ90130

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-469
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
AF2009
Species: Hu
Applications: WB, IHC
NBP2-42643
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-204
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P

Publications for DYM Antibody (NBP2-13942) (0)

There are no publications for DYM Antibody (NBP2-13942).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYM Antibody (NBP2-13942) (0)

There are no reviews for DYM Antibody (NBP2-13942). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DYM Antibody (NBP2-13942) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DYM Products

Bioinformatics Tool for DYM Antibody (NBP2-13942)

Discover related pathways, diseases and genes to DYM Antibody (NBP2-13942). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYM Antibody (NBP2-13942)

Discover more about diseases related to DYM Antibody (NBP2-13942).
 

Pathways for DYM Antibody (NBP2-13942)

View related products by pathway.

PTMs for DYM Antibody (NBP2-13942)

Learn more about PTMs related to DYM Antibody (NBP2-13942).

Blogs on DYM

There are no specific blogs for DYM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DYM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYM