NDNL2 Antibody (4F7) - Azide and BSA Free

Western Blot: NDNL2 Antibody (4F7) [H00056160-M02-100ug] - Detection against Immunogen (31.35 KDa) .

ELISA: NDNL2 Antibody (4F7) [H00056160-M02-100ug] - Detection limit for recombinant GST tagged NDNL2 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDNL2 Antibody (4F7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse NDNL2 Antibody (4F7) - Azide and BSA Free (H00056160-M02-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: NDNL2 (NP_619649.1, 2 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSR
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NDNL2
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDNL2 Antibody (4F7) - Azide and BSA Free

• HCA4hepatocellular carcinoma-associated protein HCA4
• Hepatocellular carcinoma-associated protein 4
• MAGEG1MAGE-G1 antigen
• MAGEL3
• melanoma antigen, family G, 1
• melanoma-associated antigen G1
• necdin-like 2
• necdin-like gene 2
• Necdin-like protein 2
• NSE3
• NSMCE3

Background

This intronless gene encodes a member of the MAGE superfamily. The encoded protein is 76% identical to the mouse mage-g1 protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDNL2
• Entrez:
  • 56160(Human)
• OMIM:
  • 608243(Human)
• Uniprot:
  • NP_619649.1(Human)