SMC6L1 Antibody (2E6)

Images

 
Western Blot: SMC6L1 Antibody (2E6) [H00079677-M01] - SMC6L1 monoclonal antibody (M01), clone 2E6 Analysis of SMC6L1 expression in HeLa.
Immunohistochemistry-Paraffin: SMC6L1 Antibody (2E6) [H00079677-M01] - Analysis of monoclonal antibody to SMC6L1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
ELISA: SMC6L1 Antibody (2E6) [H00079677-M01] - Detection limit for recombinant GST tagged SMC6L1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, ELISA, IHC, IHC-P, IP, S-ELISA
Clone
2E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SMC6L1 Antibody (2E6) Summary

Immunogen
SMC6L1 (AAH39828, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFV
Specificity
SMC6L1 - SMC6 structural maintenance of chromosomes 6-like 1 (yeast)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMC6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Chromatin Immunoprecipitation
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publication using H00079677-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMC6L1 Antibody (2E6)

  • FLJ22116
  • hSMC6
  • SMC protein 6
  • SMC6 structural maintenance of chromosomes 6-like 1 (yeast)
  • SMC6 structural maintenance of chromosomes 6-like 1
  • SMC-6
  • SMC6L1FLJ35534
  • structural maintenance of chromosomes 6
  • structural maintenance of chromosomes protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-469
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-02956
Species: Hu
Applications: WB, Flow, ICC/IF
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-14006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92200
Species: Hu
Applications: IHC, IHC-P
NBP2-03263
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-204
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-373
Species: Hu
Applications: WB, ICC/IF, IP, KD
NB100-207
Species: Hu, Mu, Ce
Applications: WB, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-41208
Species: Hu
Applications: WB
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80665
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13942
Species: Hu
Applications: IHC, IHC-P
H00056160-M02-100ug
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00084901-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SMC6L1 Antibody (H00079677-M01)(1)

Reviews for SMC6L1 Antibody (H00079677-M01) (0)

There are no reviews for SMC6L1 Antibody (H00079677-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for SMC6L1 Antibody (H00079677-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMC6L1 Products

Bioinformatics Tool for SMC6L1 Antibody (H00079677-M01)

Discover related pathways, diseases and genes to SMC6L1 Antibody (H00079677-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMC6L1 Antibody (H00079677-M01)

Discover more about diseases related to SMC6L1 Antibody (H00079677-M01).
 

Pathways for SMC6L1 Antibody (H00079677-M01)

View related products by pathway.

PTMs for SMC6L1 Antibody (H00079677-M01)

Learn more about PTMs related to SMC6L1 Antibody (H00079677-M01).
 

Research Areas for SMC6L1 Antibody (H00079677-M01)

Find related products by research area.

Blogs on SMC6L1

There are no specific blogs for SMC6L1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMC6L1 Antibody (2E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMC6
Entrez
OMIM
Uniprot