SMARCD2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SMARCD2 Antibody [NBP2-57074] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMARCD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQ
Specificity
Specificity of human SMARCD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMARCD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SMARCD2 Antibody

  • 60 kDa BRG-1/Brm-associated factor subunit B
  • BAF60B
  • BRG1-associated factor 60B
  • chromatin remodeling complex BAF60B subunit
  • CRACD2
  • mammalian chromatin remodeling complex BRG1-associated factor 60B
  • PRO2451
  • Rsc6p
  • SWI/SNF complex 60 kDa subunit B
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
  • Swp73-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61882
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87372
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006604-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-57525
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
MAB6817
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-88719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76978
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-69049
Species: Hu
Applications: IHC, IHC-P
7668-GH/CF
Species: Hu

Publications for SMARCD2 Antibody (NBP2-57074) (0)

There are no publications for SMARCD2 Antibody (NBP2-57074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCD2 Antibody (NBP2-57074) (0)

There are no reviews for SMARCD2 Antibody (NBP2-57074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMARCD2 Antibody (NBP2-57074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMARCD2 Products

Bioinformatics Tool for SMARCD2 Antibody (NBP2-57074)

Discover related pathways, diseases and genes to SMARCD2 Antibody (NBP2-57074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCD2 Antibody (NBP2-57074)

Discover more about diseases related to SMARCD2 Antibody (NBP2-57074).
 

Pathways for SMARCD2 Antibody (NBP2-57074)

View related products by pathway.

PTMs for SMARCD2 Antibody (NBP2-57074)

Learn more about PTMs related to SMARCD2 Antibody (NBP2-57074).
 

Research Areas for SMARCD2 Antibody (NBP2-57074)

Find related products by research area.

Blogs on SMARCD2

There are no specific blogs for SMARCD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMARCD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCD2