SMARCAD1 Antibody

Images

 
Western Blot: SMARCAD1 Antibody [NBP1-85023] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SMARCAD1 Antibody [NBP1-85023] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SMARCAD1 Antibody [NBP1-85023] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Western Blot: SMARCAD1 Antibody [NBP1-85023] - Analysis in human cell line MOLT-4.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMARCAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HGEESNESAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQYVSQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMARCAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMARCAD1 Protein (NBP1-85023PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMARCAD1 Antibody

  • ATP-dependent helicase 1
  • DKFZP762K2015
  • EC 3.6.1
  • EC 3.6.4.12
  • HEL1
  • hHEL1
  • KIAA1122ETL1DKFZp762K2015
  • subfamily a, containing DEAD/H box 1
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A containing DEAD/H box 1
  • SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-85006
Species: Hu
Applications: IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP1-78758
Species: Hu
Applications: WB (-), IP
NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-210
Species: Hu, Mu
Applications: WB, IP, PLA
NB100-368
Species: Hu
Applications: WB
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SMARCAD1 Antibody (NBP1-85023) (0)

There are no publications for SMARCAD1 Antibody (NBP1-85023).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCAD1 Antibody (NBP1-85023) (0)

There are no reviews for SMARCAD1 Antibody (NBP1-85023). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMARCAD1 Antibody (NBP1-85023) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMARCAD1 Products

Bioinformatics Tool for SMARCAD1 Antibody (NBP1-85023)

Discover related pathways, diseases and genes to SMARCAD1 Antibody (NBP1-85023). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCAD1 Antibody (NBP1-85023)

Discover more about diseases related to SMARCAD1 Antibody (NBP1-85023).
 

Pathways for SMARCAD1 Antibody (NBP1-85023)

View related products by pathway.

PTMs for SMARCAD1 Antibody (NBP1-85023)

Learn more about PTMs related to SMARCAD1 Antibody (NBP1-85023).
 

Research Areas for SMARCAD1 Antibody (NBP1-85023)

Find related products by research area.

Blogs on SMARCAD1

There are no specific blogs for SMARCAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMARCAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCAD1