SMARCAD1 Antibody - BSA Free

Western Blot: SMARCAD1 Antibody [NBP1-85023] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SMARCAD1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western Blot: SMARCAD1 Antibody [NBP1-85023] - Analysis in human cell line MOLT-4.

Western Blot: SMARCAD1 Antibody [NBP1-85023] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: SMARCAD1 Antibody [NBP1-85023] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SMARCAD1 Antibody [NBP1-85023] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SMARCAD1 Antibody [NBP1-85023] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: SMARCAD1 Antibody [NBP1-85023] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SMARCAD1 Antibody [NBP1-85023] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMARCAD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HGEESNESAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQYVSQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCAD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SMARCAD1 Protein (NBP1-85023PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SMARCAD1 Antibody - BSA Free

• ATP-dependent helicase 1
• DKFZP762K2015
• EC 3.6.1
• EC 3.6.4.12
• HEL1
• hHEL1
• KIAA1122ETL1DKFZp762K2015
• subfamily a, containing DEAD/H box 1
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A containing DEAD/H box 1
• SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin

Background

The SMARCs (SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin), and BAFs (BRG1-associated factors), have been identified as components of the mammalian SWI/SNF-like chromatin remodeling protein complexes. These multi-protein complexes are proposed to function as ATP-driven motors that translocate along DNA and destabilize nucleosomal structures to facilitate transcription factor binding. SMARCAD1/ETL1 is a unique member of this family in that it contains two DEAD/H box motifs, and thus is also a member of the DEAD/H-box-containing helicase superfamily. The chromosomal position of SMARCAD1 has been mapped, and it resides in a region rich in breakpoints and deletions associated with several human diseases. It is suggested to play a role in genetic instability and development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCAD1