EEFSEC Antibody

Images

 
Western Blot: EEFSEC Antibody [NBP1-83992] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-173
Immunocytochemistry/ Immunofluorescence: EEFSEC Antibody [NBP1-83992] - Staining of human cell line A-431 shows localization to nucleus, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: EEFSEC Antibody [NBP1-83992] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EEFSEC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AKFHITVGHETVMGRLMFFSPAPDNFDQEPILDSFNFSQEYLFQEQYLSKDLTPAVTDNDEADKKAGQATEGHCPRQQWALVEFEKPVTC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EEFSEC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EEFSEC Protein (NBP1-83992PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EEFSEC Antibody

  • eukaryotic elongation factor, selenocysteine-tRNA-specific

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-53795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13293
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88541
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi

Publications for EEFSEC Antibody (NBP1-83992) (0)

There are no publications for EEFSEC Antibody (NBP1-83992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EEFSEC Antibody (NBP1-83992) (0)

There are no reviews for EEFSEC Antibody (NBP1-83992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EEFSEC Antibody (NBP1-83992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EEFSEC Products

Bioinformatics Tool for EEFSEC Antibody (NBP1-83992)

Discover related pathways, diseases and genes to EEFSEC Antibody (NBP1-83992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EEFSEC Antibody (NBP1-83992)

Discover more about diseases related to EEFSEC Antibody (NBP1-83992).
 

Pathways for EEFSEC Antibody (NBP1-83992)

View related products by pathway.

PTMs for EEFSEC Antibody (NBP1-83992)

Learn more about PTMs related to EEFSEC Antibody (NBP1-83992).

Blogs on EEFSEC

There are no specific blogs for EEFSEC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EEFSEC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EEFSEC