Recombinant Human Smad7 Protein

Images

 
SDS-Page: Recombinant Human Smad7 Protein [H00004092-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Smad7 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 160 - 260 of Human SMAD7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SMAD7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Smad7 Protein

  • CRCS3
  • FLJ16482
  • hSMAD7
  • MAD homolog 7
  • MAD homolog 8
  • MAD, mothers against decapentaplegic homolog 7 (Drosophila)
  • MADH7
  • MADH7mothers against decapentaplegic homolog 7
  • MADH8
  • Mothers against decapentaplegic homolog 8
  • Mothers against decapentaplegic, drosophila, homolog of, 7
  • Mothers against DPP homolog 7
  • Mothers against DPP homolog 8
  • SMAD 7
  • SMAD family member 7MAD (mothers against decapentaplegic, Drosophila) homolog 7
  • SMAD, mothers against DPP homolog 7 (Drosophila)
  • SMAD, mothers against DPP homolog 7
  • Smad7

Background

SMAD7 - SMAD, mothers against DPP homolog 7 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00004092-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Smad7 Partial Recombinant Protein (H00004092-Q01) (0)

There are no publications for Smad7 Partial Recombinant Protein (H00004092-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad7 Partial Recombinant Protein (H00004092-Q01) (0)

There are no reviews for Smad7 Partial Recombinant Protein (H00004092-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smad7 Partial Recombinant Protein (H00004092-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Smad7 Products

Bioinformatics Tool for Smad7 Partial Recombinant Protein (H00004092-Q01)

Discover related pathways, diseases and genes to Smad7 Partial Recombinant Protein (H00004092-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad7 Partial Recombinant Protein (H00004092-Q01)

Discover more about diseases related to Smad7 Partial Recombinant Protein (H00004092-Q01).
 

Pathways for Smad7 Partial Recombinant Protein (H00004092-Q01)

View related products by pathway.

PTMs for Smad7 Partial Recombinant Protein (H00004092-Q01)

Learn more about PTMs related to Smad7 Partial Recombinant Protein (H00004092-Q01).

Blogs on Smad7

There are no specific blogs for Smad7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Smad7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD7
Entrez