Smad7 Antibody (3G8)

Images

 
Immunocytochemistry/ Immunofluorescence: Smad7 Antibody (3G8) [H00004092-M01] - Analysis of monoclonal antibody to SMAD7 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Smad7 Antibody (3G8) [H00004092-M01] - Detection limit for recombinant GST tagged SMAD7 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Smad7 Antibody (3G8) Summary

Immunogen
SMAD7 (NP_005895 160 a.a. - 260 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH
Specificity
SMAD7 - SMAD, mothers against DPP homolog 7 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMAD7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smad7 Antibody (3G8)

  • CRCS3
  • FLJ16482
  • hSMAD7
  • MAD homolog 7
  • MAD homolog 8
  • MAD, mothers against decapentaplegic homolog 7 (Drosophila)
  • MADH7
  • MADH7mothers against decapentaplegic homolog 7
  • MADH8
  • Mothers against decapentaplegic homolog 8
  • Mothers against decapentaplegic, drosophila, homolog of, 7
  • Mothers against DPP homolog 7
  • Mothers against DPP homolog 8
  • SMAD 7
  • SMAD family member 7MAD (mothers against decapentaplegic, Drosophila) homolog 7
  • SMAD, mothers against DPP homolog 7 (Drosophila)
  • SMAD, mothers against DPP homolog 7
  • Smad7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00004092-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Smad7 Antibody (H00004092-M01) (0)

There are no publications for Smad7 Antibody (H00004092-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad7 Antibody (H00004092-M01) (0)

There are no reviews for Smad7 Antibody (H00004092-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Smad7 Antibody (H00004092-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Smad7 Products

Bioinformatics Tool for Smad7 Antibody (H00004092-M01)

Discover related pathways, diseases and genes to Smad7 Antibody (H00004092-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad7 Antibody (H00004092-M01)

Discover more about diseases related to Smad7 Antibody (H00004092-M01).
 

Pathways for Smad7 Antibody (H00004092-M01)

View related products by pathway.

PTMs for Smad7 Antibody (H00004092-M01)

Learn more about PTMs related to Smad7 Antibody (H00004092-M01).

Blogs on Smad7

There are no specific blogs for Smad7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smad7 Antibody (3G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD7
Entrez
OMIM
Uniprot