SLPI Antibody (3C6)

Images

 
Western Blot: SLPI Antibody (3C6) [H00006590-M01] - Analysis of SLPI expression in transfected 293T cell line by SLPI monoclonal antibody (M01), clone 3C6.Lane 1: SLPI transfected lysate (Predicted MW: 14.52 KDa).Lane ...read more
Sandwich ELISA: SLPI Antibody (3C6) [H00006590-M01] - Detection limit for recombinant GST tagged SLPI is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLPI Antibody (3C6) Summary

Immunogen
SLPI (NP_003055, 33 a.a. - 132 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Specificity
SLPI (3C6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLPI
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLPI Antibody (3C6)

  • ALK1
  • ALPProtease inhibitor WAP4
  • antileukoproteinase
  • BLPISeminal proteinase inhibitor
  • HUSI
  • HUSI-I
  • Mucus proteinase inhibitor
  • secretory leukocyte peptidase inhibitor
  • secretory leukocyte protease inhibitor (antileukoproteinase)
  • Secretory leukocyte protease inhibitor
  • SLPI
  • WAP four-disulfide core domain protein 4
  • WAP4HUSI-1
  • WFDC4MPI

Background

This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP2-35213
Species: Hu
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-54724
Species: Hu
Applications: WB, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP

Publications for SLPI Antibody (H00006590-M01) (0)

There are no publications for SLPI Antibody (H00006590-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLPI Antibody (H00006590-M01) (0)

There are no reviews for SLPI Antibody (H00006590-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLPI Antibody (H00006590-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLPI Products

Bioinformatics Tool for SLPI Antibody (H00006590-M01)

Discover related pathways, diseases and genes to SLPI Antibody (H00006590-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLPI Antibody (H00006590-M01)

Discover more about diseases related to SLPI Antibody (H00006590-M01).
 

Pathways for SLPI Antibody (H00006590-M01)

View related products by pathway.

PTMs for SLPI Antibody (H00006590-M01)

Learn more about PTMs related to SLPI Antibody (H00006590-M01).
 

Research Areas for SLPI Antibody (H00006590-M01)

Find related products by research area.

Blogs on SLPI

There are no specific blogs for SLPI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLPI Antibody (3C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLPI
Entrez
OMIM
Uniprot