Slit3 Antibody (1D11)

Images

 
ELISA: Slit3 Antibody (1D11) [H00006586-M07] - Detection limit for recombinant GST tagged SLIT3 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Slit3 Antibody (1D11) Summary

Immunogen
SLIT3 (NP_003053 1371 a.a. - 1470 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA
Specificity
SLIT3 - slit homolog 3 (Drosophila) (1D11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLIT3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Slit3 Antibody (1D11)

  • KIAA0814
  • MEGF5
  • MEGF5Multiple epidermal growth factor-like domains protein 5
  • Multiple EGF-like domains protein 5
  • SLIL2
  • SLIL2FLJ10764
  • slit homolog 3 (Drosophila)
  • slit homolog 3 protein
  • SLIT1
  • slit2
  • Slit3
  • Slit-3slit (Drosophila) homolog 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1749
Species: Rt
Applications: WB, IHC
AF3147
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-58778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3155
Species: Mu
Applications: WB, IHC
AF844
Species: Mu
Applications: WB, Block
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
AF1166
Species: Mu
Applications: WB
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Slit3 Antibody (H00006586-M07) (0)

There are no publications for Slit3 Antibody (H00006586-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slit3 Antibody (H00006586-M07) (0)

There are no reviews for Slit3 Antibody (H00006586-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Slit3 Antibody (H00006586-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Slit3 Products

Bioinformatics Tool for Slit3 Antibody (H00006586-M07)

Discover related pathways, diseases and genes to Slit3 Antibody (H00006586-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slit3 Antibody (H00006586-M07)

Discover more about diseases related to Slit3 Antibody (H00006586-M07).
 

Pathways for Slit3 Antibody (H00006586-M07)

View related products by pathway.

PTMs for Slit3 Antibody (H00006586-M07)

Learn more about PTMs related to Slit3 Antibody (H00006586-M07).
 

Research Areas for Slit3 Antibody (H00006586-M07)

Find related products by research area.

Blogs on Slit3

There are no specific blogs for Slit3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Slit3 Antibody (1D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLIT3
Entrez
Uniprot