SLFN12L Antibody - BSA Free

Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SLFN12L Antibody [NBP1-91060] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: Flow, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLFN12L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLFN12L Antibody - BSA Free (NBP1-91060) is a polyclonal antibody validated for use in IHC and Flow. Anti-SLFN12L Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NRVKQLTEKEWIQFMVDSEPVCEELPSPASTSSPVSQSYPLREYINFKIQPLRYHLPGLSEKITCAPKTFCRNLFSQHEGLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLFN12L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: Use in Flow reported in scientific literature (PMID:35487288) For IHC-Paraffin, HIER pH 6 retrieval is recommended..
• Control Peptide:

  SLFN12L Protein (NBP1-91060PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLFN12L Antibody - BSA Free

• FLJ23922
• schlafen family member 12-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLFN12L Antibody (NBP1-91060)(3)

Publications using NBP1-91060

• Ding L, Chakrabarti J, Sheriff S et al. Toll Like Receptor 9 Pathway Mediates Schlafen+-MDSC Polarization During Helicobacter-Induced Gastric Metaplasias Gastroenterology 2022-04-26 [PMID: 35487288] (IF/IHC, FLOW, Mouse)
• Ding L, Li Q, Chakrabarti J et al. MiR130b from Schlafen4+ MDSCs stimulates epithelial proliferation and correlates with preneoplastic changes prior to gastric cancer Gut 2020-01-24 [PMID: 31980446] (IF/IHC, Human)
• Ding L, Hayes MM, Photenhauer A et al. Schlafen 4-expressing myeloid-derived suppressor cells are induced during murine gastric metaplasia J. Clin. Invest. 2016-08-01 [PMID: 27427984]

Bioinformatics

• Gene Symbol: SLFN12L