SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen

Images

 
There are currently no images for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen (NBP2-57729PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC6A4/5-HTTLPR/Serotonin transporter.

Source: E. coli

Amino Acid Sequence: KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC6A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57729.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen

  • 5HT transporter
  • 5-HT Transporter
  • 5-HTT
  • 5HTTLPR
  • 5-HTTLPR
  • hSERT
  • HTT5-hydroxytryptamine transporter
  • Na+/Cl- dependent serotonin transporter
  • OCD1
  • Serotonin Transporter 1
  • SERT
  • SLC6A4
  • sodium-dependent serotonin transporter
  • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
  • Solute carrier family 6 member 4,5HTT

Background

Serotonin transporter encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DBD00
Species: Hu
Applications: ELISA
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP2-38868
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-48739
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-21590
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, Simple Western, WB
NBP1-86922
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP1-47977
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC,  IHC-P, WB
NB100-74555
Species: Hu, Mu, Pm, Rb, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
H00006999-B01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NBP2-57729PEP
Species: Hu
Applications: AC

Publications for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen (NBP2-57729PEP) (0)

There are no publications for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen (NBP2-57729PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen (NBP2-57729PEP) (0)

There are no reviews for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen (NBP2-57729PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen (NBP2-57729PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC6A4/5-HTTLPR/Serotonin transporter Products

Research Areas for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen (NBP2-57729PEP)

Find related products by research area.

Blogs on SLC6A4/5-HTTLPR/Serotonin transporter.

Epigenetics of Depression: How Can Psychological Stress Alter Your DNA?
By Emily Cartwright, PhDHow Can Psychological Stress Alter Your DNA? Traumatic events, work demands, relationship conflicts, and health problems are all examples of psychological stressors that can result in phy...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A4