SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9)

ELISA: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9) [H00006532-M06] - Detection limit for recombinant GST tagged SLC6A4 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: ELISA, IP
• Clone: 2A9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SLC6A4 (NP_001036, 181 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS
• Specificity: SLC6A4 (2A9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC6A4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
• Application Notes: Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. IP usage was reported in scientific literature.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 22451649).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9)

• 5HT transporter
• 5-HT Transporter
• 5-HTT
• 5HTTLPR
• 5-HTTLPR
• hSERT
• HTT5-hydroxytryptamine transporter
• Na+/Cl- dependent serotonin transporter
• OCD1
• Serotonin Transporter 1
• SERT
• SLC6A4
• sodium-dependent serotonin transporter
• solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
• Solute carrier family 6 member 4,5HTT

Background

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-M06)(1)

Publication using H00006532-M06

• Freyaldenhoven S, Li Y, Kocabas AM et al. The role of ERp44 in maturation of serotonin transporter protein J Biol Chem 2012-05-01 [PMID: 22451649] (IP, Rat)

Review for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-M06) (1)

Average Rating: 4

(Based on 1 review)

reviewed by: Verified Customer IP 11/07/2012

Summary

• Application: Immunoprecipitation

Bioinformatics

• Gene Symbol: SLC6A4
• Entrez:
  • 6532(Human)
• OMIM:
  • 164230(Human)
• Uniprot:
  • NP_001036()