| Reactivity | Hu, RtSpecies Glossary |
| Applications | ELISA, IP |
| Clone | 2A9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC6A4 (NP_001036, 181 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS |
| Specificity | SLC6A4 (2A9) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC6A4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. IP usage was reported in scientific literature. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00006532-M06 | Applications | Species |
|---|---|---|
| Freyaldenhoven S, Li Y, Kocabas AM et al. The role of ERp44 in maturation of serotonin transporter protein J Biol Chem 2012-05-01 [PMID: 22451649] (IP, Rat) | IP | Rat |
| Images | Ratings | Applications | Species | Date | Details | ||
|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IP | 11/07/2012 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (H00006532-M06)Find related products by research area.
|
|
Epigenetics of Depression: How Can Psychological Stress Alter Your DNA? By Emily Cartwright, PhDHow Can Psychological Stress Alter Your DNA? Traumatic events, work demands, relationship conflicts, and health problems are all examples of psychological stressors that can result in phy... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.