SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9)


ELISA: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9) [H00006532-M06] - Detection limit for recombinant GST tagged SLC6A4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA, IP

Order Details

SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9) Summary

SLC6A4 (NP_001036, 181 a.a. - 252 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS
SLC6A4 (2A9)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunoprecipitation
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. IP usage was reported in scientific literature.
Reviewed Applications
Read 1 Review rated 4
H00006532-M06 in the following applications:

Read Publication using
H00006532-M06 in the following applications:

  • IP
    1 publication

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9)

  • 5HT transporter
  • 5-HT Transporter
  • 5-HTT
  • 5-HTTLPR
  • hSERT
  • HTT5-hydroxytryptamine transporter
  • Na+/Cl- dependent serotonin transporter
  • OCD1
  • Serotonin Transporter 1
  • SERT
  • SLC6A4
  • sodium-dependent serotonin transporter
  • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
  • Solute carrier family 6 member 4,5HTT


This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, TCS
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: Flow, IHC, CyTOF-ready

Publications for Serotonin transporter Antibody (H00006532-M06)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IP.

Filter By Application
All Applications
Filter By Species
All Species

Review for Serotonin transporter Antibody (H00006532-M06) (1) 41

Average Rating: 4
(Based on 1 review)

Reviews using H00006532-M06:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunoprecipitation SLC6A4/5-HTTLPR/Serotonin transporter H00006532-M06
reviewed by:
IP 11/07/2012


FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Serotonin transporter Antibody (H00006532-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC6A4/5-HTTLPR/Serotonin transporter Products

Bioinformatics Tool for Serotonin transporter Antibody (H00006532-M06)

Discover related pathways, diseases and genes to Serotonin transporter Antibody (H00006532-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serotonin transporter Antibody (H00006532-M06)

Discover more about diseases related to Serotonin transporter Antibody (H00006532-M06).

Pathways for Serotonin transporter Antibody (H00006532-M06)

View related products by pathway.

PTMs for Serotonin transporter Antibody (H00006532-M06)

Learn more about PTMs related to Serotonin transporter Antibody (H00006532-M06).

Research Areas for Serotonin transporter Antibody (H00006532-M06)

Find related products by research area.

Blogs on SLC6A4/5-HTTLPR/Serotonin transporter

There are no specific blogs for SLC6A4/5-HTTLPR/Serotonin transporter, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IP


Gene Symbol SLC6A4