SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9)

Images

 
ELISA: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9) [H00006532-M06] - Detection limit for recombinant GST tagged SLC6A4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP
Clone
2A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9) Summary

Immunogen
SLC6A4 (NP_001036, 181 a.a. - 252 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS
Specificity
SLC6A4 (2A9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC6A4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. IP usage was reported in scientific literature.
Reviewed Applications
Read 1 Review rated 4
using
H00006532-M06 in the following applications:

Publications
Read Publication using
H00006532-M06 in the following applications:

  • IP
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9)

  • 5HT transporter
  • 5-HT Transporter
  • 5-HTT
  • 5HTTLPR
  • 5-HTTLPR
  • hSERT
  • HTT5-hydroxytryptamine transporter
  • Na+/Cl- dependent serotonin transporter
  • OCD1
  • Serotonin Transporter 1
  • SERT
  • SLC6A4
  • sodium-dependent serotonin transporter
  • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
  • Solute carrier family 6 member 4,5HTT

Background

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-60120
Species: Hu
Applications: WB, TCS
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
H00001815-R02
Species: Hu
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5276
Species: Hu
Applications: WB, IHC
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74555
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-45995
Species: Hu
Applications: WB, IHC
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready

Publications for Serotonin transporter Antibody (H00006532-M06)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Review for Serotonin transporter Antibody (H00006532-M06) (1) 41

Average Rating: 4
(Based on 1 review)

Reviews using H00006532-M06:
Filter by Applications
IP
(1)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunoprecipitation SLC6A4/5-HTTLPR/Serotonin transporter H00006532-M06
Enlarge
reviewed by:
Anonymous
IP 11/07/2012
View

Summary

ApplicationImmunoprecipitation
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Serotonin transporter Antibody (H00006532-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC6A4/5-HTTLPR/Serotonin transporter Products

Bioinformatics Tool for Serotonin transporter Antibody (H00006532-M06)

Discover related pathways, diseases and genes to Serotonin transporter Antibody (H00006532-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serotonin transporter Antibody (H00006532-M06)

Discover more about diseases related to Serotonin transporter Antibody (H00006532-M06).
 

Pathways for Serotonin transporter Antibody (H00006532-M06)

View related products by pathway.

PTMs for Serotonin transporter Antibody (H00006532-M06)

Learn more about PTMs related to Serotonin transporter Antibody (H00006532-M06).
 

Research Areas for Serotonin transporter Antibody (H00006532-M06)

Find related products by research area.

Blogs on SLC6A4/5-HTTLPR/Serotonin transporter

There are no specific blogs for SLC6A4/5-HTTLPR/Serotonin transporter, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
11/07/2012
Application: IP
Species:

Bioinformatics

Gene Symbol SLC6A4
Entrez
OMIM
Uniprot