SLC6A19 Antibody


Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP1-86277] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP1-86277] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP1-86277] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SLC6A19 Antibody [NBP1-86277] - Staining in human small intestine and pancreas tissues using anti-SLC6A19 antibody. Corresponding SLC6A19 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SLC6A19 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGT
Specificity of human SLC6A19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC6A19 Protein (NBP1-86277PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC6A19 Antibody

  • B0AT1
  • FLJ20680
  • FLJ34635
  • HND
  • sodium-dependent amino acid transporter system B0
  • sodium-dependent neutral amino acid transporter B(0)AT1
  • solute carrier family 6 (neurotransmitter transporter), member 19
  • solute carrier family 6 (neutral amino acid transporter), member 19
  • Solute carrier family 6 member 19
  • System B(0) neutral amino acid transporter AT1
  • system B0 neutral amino acid transporter


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for SLC6A19 Antibody (NBP1-86277) (0)

There are no publications for SLC6A19 Antibody (NBP1-86277).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A19 Antibody (NBP1-86277) (0)

There are no reviews for SLC6A19 Antibody (NBP1-86277). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC6A19 Antibody (NBP1-86277) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC6A19 Products

Bioinformatics Tool for SLC6A19 Antibody (NBP1-86277)

Discover related pathways, diseases and genes to SLC6A19 Antibody (NBP1-86277). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A19 Antibody (NBP1-86277)

Discover more about diseases related to SLC6A19 Antibody (NBP1-86277).

Pathways for SLC6A19 Antibody (NBP1-86277)

View related products by pathway.

PTMs for SLC6A19 Antibody (NBP1-86277)

Learn more about PTMs related to SLC6A19 Antibody (NBP1-86277).

Blogs on SLC6A19

There are no specific blogs for SLC6A19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC6A19 Antibody and receive a gift card or discount.


Gene Symbol SLC6A19