SLC5A8/SMCT1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC5A8/SMCT1. Peptide sequence CNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFSTVGT |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC5A8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
67 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SLC5A8/SMCT1 Antibody - BSA Free
Background
SLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 (PubMed 12107270)) andmonocarboxylates and short-chain fatty acids by a sodium-coupled mechanism (Gopal et al., 2004 (PubMed 15322102)). Inkidney, SLC5A8 functions as a high-affinity sodium-coupled lactate transporter involved in reabsorption of lactate andmaintenance of blood lactate levels (Thangaraju et al., 2006 (PubMed 16873376)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Publications for SLC5A8/SMCT1 Antibody (NBP3-10577) (0)
There are no publications for SLC5A8/SMCT1 Antibody (NBP3-10577).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC5A8/SMCT1 Antibody (NBP3-10577) (0)
There are no reviews for SLC5A8/SMCT1 Antibody (NBP3-10577).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC5A8/SMCT1 Antibody (NBP3-10577) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC5A8/SMCT1 Products
Blogs on SLC5A8/SMCT1