SLC5A5/Sodium Iodide Symporter Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC5A5/Sodium Iodide Symporter Antibody [NBP2-33547] - Analysis in human salivary gland and placenta tissues using HPA049055 antibody. Corresponding SLC5A5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SLC5A5/Sodium Iodide Symporter Antibody [NBP2-33547] - Staining in rat salivary gland. Image from a verified customer review.

Immunohistochemistry-Paraffin: SLC5A5/Sodium Iodide Symporter Antibody [NBP2-33547] - Staining of human salivary gland shows membranous positivity in ductal cells.

Immunohistochemistry-Paraffin: SLC5A5/Sodium Iodide Symporter Antibody [NBP2-33547] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC5A5/Sodium Iodide Symporter Antibody [NBP2-33547] - Staining of human placenta shows no positivity in trophoblastic cells.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC5A5/Sodium Iodide Symporter Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC5A5/Sodium Iodide Symporter Antibody - BSA Free (NBP2-33547) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC5A5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC5A5/Sodium Iodide Symporter Protein (NBP2-33547PEP)

Reactivity Notes

Rat reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC5A5/Sodium Iodide Symporter Antibody - BSA Free

• Na(+)/I(-) cotransporter
• Na(+)/I(-) symporter
• NIS
• NISNa(+)/I(-)-symporter
• SLC5A5
• sodium/iodide cotransporter
• Sodium-iodide symporter
• solute carrier family 5 (sodium iodide symporter), member 5
• Solute carrier family 5 member 5
• TDH1

Background

The Sodium Iodide Symporter gene encodes a member of the sodium glucose cotransporter family. The encoded protein is responsible for the uptake of iodine in tissues such as the thyroid and lactating breast tissue. The iodine taken up by the thyroid is incorporated into the meta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for SLC5A5/Sodium Iodide Symporter Antibody (NBP2-33547) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Odette Birko IHC-P Rat 09/12/2018

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Salivary gland tissue
• Species: Rat
• Lot: C1 17719

Comments

• Comments: pH9 as TRS gives a nicer staining than with pH6

Bioinformatics

• Gene Symbol: SLC5A5
• Uniprot:
  • Q92911()