IYD Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IYD Antibody [NBP2-31786] - Staining of human cell line CACO-2 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: IYD Antibody [NBP2-31786] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IYD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IYD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IYD Protein (NBP2-31786PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IYD Antibody

  • C6orf71
  • DEHAL1chromosome 6 open reading frame 71
  • dJ422F24.1
  • iodotyrosine dehalogenase 1
  • iodotyrosine deiodinase
  • IYD-1
  • TDH4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-70342
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NB110-61576
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, ICC/IF, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF482
Species: Mu
Applications: WB, IHC
NBP1-93470
Species: Hu
Applications: IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF6574
Species: Mu
Applications: WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for IYD Antibody (NBP2-31786) (0)

There are no publications for IYD Antibody (NBP2-31786).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IYD Antibody (NBP2-31786) (0)

There are no reviews for IYD Antibody (NBP2-31786). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IYD Antibody (NBP2-31786) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IYD Products

Bioinformatics Tool for IYD Antibody (NBP2-31786)

Discover related pathways, diseases and genes to IYD Antibody (NBP2-31786). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IYD Antibody (NBP2-31786)

Discover more about diseases related to IYD Antibody (NBP2-31786).
 

Pathways for IYD Antibody (NBP2-31786)

View related products by pathway.

PTMs for IYD Antibody (NBP2-31786)

Learn more about PTMs related to IYD Antibody (NBP2-31786).

Blogs on IYD

There are no specific blogs for IYD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IYD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IYD
Uniprot