IYD Antibody


Western Blot: IYD Antibody [NBP2-31786] - Staining in human thyroid gland and cerebral cortex tissues using anti-IYD antibody. Corresponding IYD RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: IYD Antibody [NBP2-31786] - Staining of human cell line CACO-2 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: IYD Antibody [NBP2-31786] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: IYD Antibody [NBP2-31786] - Staining of human cerebral cortex shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

IYD Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK
Specificity of human IYD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IYD Protein (NBP2-31786PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IYD Antibody

  • C6orf71
  • DEHAL1chromosome 6 open reading frame 71
  • dJ422F24.1
  • iodotyrosine dehalogenase 1
  • iodotyrosine deiodinase
  • IYD-1
  • TDH4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for IYD Antibody (NBP2-31786) (0)

There are no publications for IYD Antibody (NBP2-31786).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IYD Antibody (NBP2-31786) (0)

There are no reviews for IYD Antibody (NBP2-31786). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IYD Antibody (NBP2-31786) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IYD Products

Bioinformatics Tool for IYD Antibody (NBP2-31786)

Discover related pathways, diseases and genes to IYD Antibody (NBP2-31786). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IYD Antibody (NBP2-31786)

Discover more about diseases related to IYD Antibody (NBP2-31786).

Pathways for IYD Antibody (NBP2-31786)

View related products by pathway.

PTMs for IYD Antibody (NBP2-31786)

Learn more about PTMs related to IYD Antibody (NBP2-31786).

Blogs on IYD

There are no specific blogs for IYD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IYD Antibody and receive a gift card or discount.


Gene Symbol IYD