SLC4A4 Antibody - BSA Free

Western Blot: SLC4A4 Antibody [NBP2-94138] - Western blot analysis of extracts of LNCaP cells, using SLC4A4 antibody (NBP2-94138) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: SLC4A4 Antibody [NBP2-94138] - Western blot analysis of extracts of various cell lines, using SLC4A4 antibody (NBP2-94138) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: SLC4A4 Antibody - Azide and BSA Free [SLC4A4] - Immunofluorescence analysis of C6 cells using SLC4A4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC4A4 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 978-1078 of human SLC4A4 (NP_001091954.1). VMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC4A4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 121 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC4A4 Antibody - BSA Free

• electrogenic sodium bicarbonate cotransporter 1
• hhNMC
• HNBC1
• KNBC
• kNBC1
• Na(+)/HCO3(-) cotransporter
• NBC
• NBC1DKFZp781H1314
• NBC2
• NBCE1
• pNBC
• SLC4A5
• sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas)
• Sodium bicarbonate cotransporter
• Solute carrier family 4 member 4
• solute carrier family 4, sodium bicarbonate cotransporter, member 4
• solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type
• solute carrier family 4, sodium bicarbonate cotransporter, member 5

Background

SLC4A4 - solute carrier family 4, sodium bicarbonate cotransporter, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

FAQs for SLC4A4 Antibody (NBP2-94138). (Showing 1 - 1 of 1 FAQ).

1. Have any of your SLC4A4 antibodies been tested for use in IHC?
   • The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.

Bioinformatics

• Gene Symbol: SLC4A4