SLC45A3/Prostein Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC45A3/Prostein Antibody [NBP1-89629] - Staining in human prostate and liver tissues using NBP1-89629 antibody. Corresponding SLC45A3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SLC45A3/Prostein Antibody [NBP1-89629] - Staining of human liver, placenta, prostate and testis using Anti-SLC45A3 antibody NBP1-89629 (A) shows similar protein distribution across tissues to independent antibody NBP1-89630 (B).

Immunocytochemistry/Immunofluorescence: SLC45A3/Prostein Antibody [NBP1-89629] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SLC45A3/Prostein Antibody [NBP1-89629] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: SLC45A3/Prostein Antibody [NBP1-89629] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: SLC45A3/Prostein Antibody [NBP1-89629] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC45A3/Prostein Antibody [NBP1-89629] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC45A3/Prostein Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP
• Marker: Prostate Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC45A3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC45A3/Prostein Recombinant Protein Antigen (NBP1-89629PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC45A3/Prostein Antibody - BSA Free

• IPCA-2
• IPCA-6
• IPCA-8
• PCANAP2
• PCANAP6
• PCANAP6IPCA6
• PCANAP8
• prostate cancer associated protein 2
• prostate cancer associated protein 6
• prostate cancer associated protein 8
• prostate cancer-associated gene 2
• prostate cancer-associated gene 6
• prostate cancer-associated gene 8
• Prostate cancer-associated protein 6
• Prostein
• PRST
• PRSTPCANAP2
• S45A3
• SLC45A3
• solute carrier family 45 member 3
• solute carrier family 45, member 3

Background

Prostein is a novel prostate-specific protein expressed in normal and malignant prostate tissues. This protein appears to be a type IIIa plasma membrane protein with a cleavable signal peptide and 11 transmembrane-spanning regions. Prostein expression is androgen responsive since treatment of LNCaP cells with androgen up-regulates prostein message and protein expression levels. Thus, prostein is a prostate-specific marker whose detection and quantitation may be useful in diagnosing and monitoring prostate cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC45A3