SLC45A3/Prostein Antibody

Images

 
Western Blot: SLC45A3/Prostein Antibody [NBP1-89629] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: SLC45A3/Prostein Antibody [NBP1-89629] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: SLC45A3/Prostein Antibody [NBP1-89629] - Staining of human prostate shows strong cytoplasmic positivity, with a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC45A3/Prostein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP
Marker
Prostate Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC45A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC45A3/Prostein Recombinant Protein Antigen (NBP1-89629PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC45A3/Prostein Antibody

  • IPCA-2
  • IPCA-6
  • IPCA-8
  • PCANAP2
  • PCANAP6
  • PCANAP6IPCA6
  • PCANAP8
  • prostate cancer associated protein 2
  • prostate cancer associated protein 6
  • prostate cancer associated protein 8
  • prostate cancer-associated gene 2
  • prostate cancer-associated gene 6
  • prostate cancer-associated gene 8
  • Prostate cancer-associated protein 6
  • Prostein
  • PRST
  • PRSTPCANAP2
  • S45A3
  • SLC45A3
  • solute carrier family 45 member 3
  • solute carrier family 45, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-87960
Species: Hu
Applications: ICC/IF, IHC, IHC-P
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-89629
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC45A3/Prostein Antibody (NBP1-89629) (0)

There are no publications for SLC45A3/Prostein Antibody (NBP1-89629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC45A3/Prostein Antibody (NBP1-89629) (0)

There are no reviews for SLC45A3/Prostein Antibody (NBP1-89629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC45A3/Prostein Antibody (NBP1-89629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC45A3/Prostein Products

Bioinformatics Tool for SLC45A3/Prostein Antibody (NBP1-89629)

Discover related pathways, diseases and genes to SLC45A3/Prostein Antibody (NBP1-89629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC45A3/Prostein Antibody (NBP1-89629)

Discover more about diseases related to SLC45A3/Prostein Antibody (NBP1-89629).
 

Pathways for SLC45A3/Prostein Antibody (NBP1-89629)

View related products by pathway.

Blogs on SLC45A3/Prostein

There are no specific blogs for SLC45A3/Prostein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC45A3/Prostein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC45A3
Entrez