SLC45A3/Prostein Antibody - BSA Free

Western Blot: Prostein Antibody [NBP1-69294] - This Anti-SLC45A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC45A3/Prostein Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC45A3(solute carrier family 45, member 3) The peptide sequence was selected from the middle region of SLC45A3. Peptide sequence LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Prostate Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC45A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 59 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC45A3/Prostein Antibody - BSA Free

• IPCA-2
• IPCA-6
• IPCA-8
• PCANAP2
• PCANAP6
• PCANAP6IPCA6
• PCANAP8
• prostate cancer associated protein 2
• prostate cancer associated protein 6
• prostate cancer associated protein 8
• prostate cancer-associated gene 2
• prostate cancer-associated gene 6
• prostate cancer-associated gene 8
• Prostate cancer-associated protein 6
• Prostein
• PRST
• PRSTPCANAP2
• S45A3
• SLC45A3
• solute carrier family 45 member 3
• solute carrier family 45, member 3

Background

SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC45A3
• Uniprot:
  • Q96JT2(Human)