SLC45A3/Prostein Antibody

Images

 
Western Blot: Prostein Antibody [NBP1-69294] - This Anti-SLC45A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC45A3/Prostein Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC45A3(solute carrier family 45, member 3) The peptide sequence was selected from the middle region of SLC45A3. Peptide sequence LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS.
Marker
Prostate Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC45A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC45A3 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC45A3/Prostein Antibody

  • IPCA-2
  • IPCA-6
  • IPCA-8
  • PCANAP2
  • PCANAP6
  • PCANAP6IPCA6
  • PCANAP8
  • prostate cancer associated protein 2
  • prostate cancer associated protein 6
  • prostate cancer associated protein 8
  • prostate cancer-associated gene 2
  • prostate cancer-associated gene 6
  • prostate cancer-associated gene 8
  • Prostate cancer-associated protein 6
  • Prostein
  • PRST
  • PRSTPCANAP2
  • S45A3
  • SLC45A3
  • solute carrier family 45 member 3
  • solute carrier family 45, member 3

Background

SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-87960
Species: Hu
Applications: ICC/IF, IHC, IHC-P
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-69294
Species: Hu
Applications: WB

Publications for SLC45A3/Prostein Antibody (NBP1-69294) (0)

There are no publications for SLC45A3/Prostein Antibody (NBP1-69294).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC45A3/Prostein Antibody (NBP1-69294) (0)

There are no reviews for SLC45A3/Prostein Antibody (NBP1-69294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC45A3/Prostein Antibody (NBP1-69294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC45A3/Prostein Products

Bioinformatics Tool for SLC45A3/Prostein Antibody (NBP1-69294)

Discover related pathways, diseases and genes to SLC45A3/Prostein Antibody (NBP1-69294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC45A3/Prostein Antibody (NBP1-69294)

Discover more about diseases related to SLC45A3/Prostein Antibody (NBP1-69294).
 

Pathways for SLC45A3/Prostein Antibody (NBP1-69294)

View related products by pathway.

Blogs on SLC45A3/Prostein

There are no specific blogs for SLC45A3/Prostein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC45A3/Prostein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC45A3
Entrez
Uniprot