SLC44A3 Antibody

Images

 
Western Blot: SLC44A3 Antibody [NBP2-13339] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC44A3 Antibody [NBP2-13339] - Staining in human stomach and lymph node tissues using anti-SLC44A3 antibody. Corresponding SLC44A3 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: SLC44A3 Antibody [NBP2-13339] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC44A3 Antibody [NBP2-13339] - Staining of human stomach shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLC44A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEV KGTQLNRMALCVSNCPEEQLDSLEEVQ
Specificity
Specificity of human SLC44A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC44A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC44A3 Antibody

  • choline transporter-like protein 3
  • member 3
  • MGC45474
  • solute carrier family 44, member 3
  • UNQ558/PRO1115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00057153-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
H00006143-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-74570
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
AF5507
Species: Hu, Mu
Applications: WB
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75734
Species: Hu
Applications: WB, ELISA, IHC-P, PAGE
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69368
Species: Hu, Po, Bv
Applications: WB, IHC, IHC-P
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single Cell Western

Publications for SLC44A3 Antibody (NBP2-13339) (0)

There are no publications for SLC44A3 Antibody (NBP2-13339).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC44A3 Antibody (NBP2-13339) (0)

There are no reviews for SLC44A3 Antibody (NBP2-13339). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC44A3 Antibody (NBP2-13339) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC44A3 Products

Bioinformatics Tool for SLC44A3 Antibody (NBP2-13339)

Discover related pathways, diseases and genes to SLC44A3 Antibody (NBP2-13339). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SLC44A3

There are no specific blogs for SLC44A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC44A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC44A3