RPL19 Antibody (3H4)

Images

 
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - Analysis of RPL19 expression in transfected 293T cell line by RPL19 monoclonal antibody (M01), clone 3H4.Lane 1: RPL19 transfected lysate (Predicted MW: 23.5 ...read more
Immunocytochemistry/ Immunofluorescence: RPL19 Antibody (3H4) [H00006143-M01] - Immortalised untreated mouse dendritic cells stained with DAPI, Mettl27 and RPL19 in green. Acquisition in confocal imaging. RLP19 primary ...read more
Immunohistochemistry-Paraffin: RPL19 Antibody (3H4) [H00006143-M01] - Analysis of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. Antibody concentration 1 ~ 10 ug/ml.
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4 Analysis of RPL19 expression in HeLa.
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4. Analysis of RPL19 expression in PC-12.
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4. Analysis of RPL19 expression in Raw 264.7.
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4. Analysis of RPL19 expression in Jurkat.
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - RPL19 monoclonal antibody (M01), clone 3H4. Analysis of RPL19 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: RPL19 Antibody (3H4) [H00006143-M01] - Analysis of monoclonal antibody to RPL19 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: RPL19 Antibody (3H4) [H00006143-M01] - Detection limit for recombinant GST tagged RPL19 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, Rt, YeSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
3H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPL19 Antibody (3H4) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
RPL19 (NP_000972, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR
Specificity
RPL19 - ribosomal protein L19
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
RPL19
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Reviewed Applications
Read 1 Review rated 5
using
H00006143-M01 in the following applications:

Publications
Read Publications using
H00006143-M01 in the following applications:

  • WB
    2 publications

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL19 Antibody (3H4)

  • DKFZp779D216
  • FLJ27452
  • MGC71997,60S ribosomal protein L19
  • ribosomal protein L19
  • ribosomal protein L19, cytosolic, N-terminus truncated

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L19E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP2-13251
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-09260
Species: Hu
Applications: WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-80025
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85385
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-12600
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-06069
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-82855
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93661
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-38971
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-57476
Species: Hu
Applications: IHC, IHC-P, WB
H00006143-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC

Publications for RPL19 Antibody (H00006143-M01)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00006143-M01 Applications Species
Brody MJ, Vanhoutte D, Bakshi CV et al. Disruption of valosin-containing protein activity causes cardiomyopathy and reveals pleiotropic functions in cardiac homeostasis. J Biol Chem. 2019-04-21 [PMID: 31006653]
Albanese Christina M, Suttapitugsakul Suttipong, Perati Shruthi, McGown Linda B A genome-inspired, reverse selection approach to aptamer discovery. Talanta 2017-09-01 [PMID: 29108569] (WB, Human) WB Human
Seguin SJ, Morelli FF, Vinet J et al. Inhibition of autophagy, lysosome and VCP function impairs stress granule assembly. Cell Death Differ. 2014-07-18 [PMID: 25034784]
Kolisek M, Sponder G, Mastrototaro L et al. Substitution p.A350V in Na(+)/Mg(2+) Exchanger SLC41A1, Potentially Associated with Parkinson's Disease, Is a Gain-of-Function Mutation. PLoS One. 2013-08-15 [PMID: 23976986]
Sugihara Y, Sadohara E, Yonezawa K et al. Identification and expression of an autosomal paralogue of ribosomal protein S4, X-linked, in mice: Potential involvement of testis-specific ribosomal proteins in translation and spermatogenesis. Gene. 2013-05-25 [PMID: 23500592]
Bee A, Brewer D, Beesley C et al. siRNA Knockdown of Ribosomal Protein Gene RPL19 Abrogates the Aggressive Phenotype of Human Prostate Cancer. PLoS One. 2011-07-22 [PMID: 21799931]
Sadaie M, Shinmyozu K, Nakayama JI. A conserved SET-domain methyltransferase, Set11, modifies ribosomal protein Rpl12 in fission yeast. J Biol Chem. 2008-01-14 [PMID: 18195021]
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01
Snieckute G, Genzor AV, Vind AC et al. Ribosome stalling is a signal for metabolic regulation by the ribotoxic stress response Cell metabolism 2022-11-08 [PMID: 36384144] (WB, Human) WB Human

Review for RPL19 Antibody (H00006143-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00006143-M01:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry RPL19 H00006143-M01
Enlarge
5
reviewed by:
Catherine Bélanger
ICC Mouse 09/04/2020
View

Summary

ApplicationImmunocytochemistry
Sample TestedImmortalized mouse dendritic cells
SpeciesMouse
LotJ5161-3H4

Comments

CommentsImmunofluorescence. Acquisition in confocal imaging. RLP19 primary antibody coupled with Alexa488.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL19 Antibody (H00006143-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Catherine Bélanger
09/04/2020
Application: ICC
Species: Mouse

Bioinformatics

Gene Symbol RPL19
Entrez
OMIM
Uniprot