SLC44A2 Antibody (3D11)

Images

 
Immunohistochemistry-Paraffin: SLC44A2 Antibody (3D11) [H00057153-M01] - Analysis of monoclonal antibody to SLC44A2 on formalin-fixed paraffin-embedded human lymphoma. Antibody concentration 3 ug/ml.
ELISA: SLC44A2 Antibody (3D11) [H00057153-M01] - Detection limit for recombinant GST tagged SLC44A2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC44A2 Antibody (3D11) Summary

Immunogen
CTL2 (AAH40556, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV
Specificity
SLC44A2 - CTL2 protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC44A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00057153-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC44A2 Antibody (3D11)

  • CTL2choline transporter-like protein 2
  • DKFZp666A071
  • FLJ44586
  • PP1292
  • Solute carrier family 44 member 2
  • solute carrier family 44, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023446-A01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
5249-CH
Species: Hu
Applications: BA
NBP2-38683
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
7268-CT
Species: Hu
Applications: BA
NBP1-59683
Species: Hu
Applications: WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
H00057153-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SLC44A2 Antibody (H00057153-M01)(5)

Reviews for SLC44A2 Antibody (H00057153-M01) (0)

There are no reviews for SLC44A2 Antibody (H00057153-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC44A2 Antibody (H00057153-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC44A2 Products

Bioinformatics Tool for SLC44A2 Antibody (H00057153-M01)

Discover related pathways, diseases and genes to SLC44A2 Antibody (H00057153-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC44A2 Antibody (H00057153-M01)

Discover more about diseases related to SLC44A2 Antibody (H00057153-M01).
 

Pathways for SLC44A2 Antibody (H00057153-M01)

View related products by pathway.

PTMs for SLC44A2 Antibody (H00057153-M01)

Learn more about PTMs related to SLC44A2 Antibody (H00057153-M01).
 

Research Areas for SLC44A2 Antibody (H00057153-M01)

Find related products by research area.

Blogs on SLC44A2

There are no specific blogs for SLC44A2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC44A2 Antibody (3D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC44A2
Entrez
OMIM
Uniprot