SLC44A2 Antibody (3D11) Summary
Immunogen |
CTL2 (AAH40556, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV |
Specificity |
SLC44A2 - CTL2 protein |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SLC44A2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
Application Notes |
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SLC44A2 Antibody (3D11)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Publications for SLC44A2 Antibody (H00057153-M01)(5)
Showing Publications 1 -
5 of 5.
Publications using H00057153-M01 |
Applications |
Species |
Nishiyama R, Nagashima F, Iwao B et al. Identification and functional analysis of choline transporter in tongue cancer: A novel molecular target for tongue cancer therapy. Journal of Pharmacological Sciences 2016 May 1 [PMID: 27262903] |
|
|
Iwao B, Yara M, Hara N et al. Functional expression of choline transporter like-protein 1 (CTL1) and CTL2 in human brain microvascular endothelial cells. Neurochem Int 2015 Dec 31 [PMID: 26746385] |
|
|
Taguchi C, Inazu M, Saiki I et al. Functional analysis of [methyl-3H]choline uptake in glioblastoma cells: influence of anti-cancer and central nervous system drugs. Biochem Pharmacol. 2014 Feb 12 [PMID: 24530235] |
|
|
Bayat B, Tjahjono Y, Sydykov A et al. Anti-human neutrophil antigen-3a induced transfusion-related acute lung injury in mice by direct disturbance of lung endothelial cells. Arterioscler Thromb Vasc Biol. 2013 Sep 05 [PMID: 24008160] |
|
|
Yabuki M, Inazu M, Yamada T et al. Molecular functional characterization of choline transporter in rat renal tubule epithelial NRK-52E cells. Arch Biochem Biophys 485(1):88-96. 2009 May 1. [PMID: 19236841] |
|
|
Reviews for SLC44A2 Antibody (H00057153-M01) (0)
There are no reviews for SLC44A2 Antibody (H00057153-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC44A2 Antibody (H00057153-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC44A2 Products
Bioinformatics Tool for SLC44A2 Antibody (H00057153-M01)
Discover related pathways, diseases and genes to SLC44A2 Antibody (H00057153-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SLC44A2 Antibody (H00057153-M01)
Discover more about diseases related to SLC44A2 Antibody (H00057153-M01).
| | Pathways for SLC44A2 Antibody (H00057153-M01)
View related products by pathway.
|
PTMs for SLC44A2 Antibody (H00057153-M01)
Learn more about PTMs related to SLC44A2 Antibody (H00057153-M01).
| | Research Areas for SLC44A2 Antibody (H00057153-M01)
Find related products by research area.
|
Blogs on SLC44A2