SLC38A3 Antibody

Images

 
Western Blot: SLC38A3 Antibody [NBP1-60103] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - Dilution : 1: 200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution : 1: 200 Color/Signal Descriptions : SLC38A3: Red CtBp: Green ...read more
Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - :1:200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution :1:200 Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: Blue. ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC38A3 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against SLC38A3 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC38A3 Antibody

  • G17sodium-coupled neutral amino acid transporter 3
  • Na(+)-coupled neutral amino acid transporter 3
  • NAT1
  • N-system amino acid transporter 1
  • SN1system N1 Na+ and H+-coupled glutamine transporter
  • SNAT3
  • Solute carrier family 38 member 3
  • solute carrier family 38, member 3
  • System N amino acid transporter 1

Background

As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92402
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2869
Species: Hu, Mu, Rt, Po, Bv, Ca, GP, I, Kg, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC

Publications for SLC38A3 Antibody (NBP1-60103) (0)

There are no publications for SLC38A3 Antibody (NBP1-60103).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC38A3 Antibody (NBP1-60103) (0)

There are no reviews for SLC38A3 Antibody (NBP1-60103). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC38A3 Antibody (NBP1-60103) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC38A3 Products

Bioinformatics Tool for SLC38A3 Antibody (NBP1-60103)

Discover related pathways, diseases and genes to SLC38A3 Antibody (NBP1-60103). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC38A3 Antibody (NBP1-60103)

Discover more about diseases related to SLC38A3 Antibody (NBP1-60103).
 

Pathways for SLC38A3 Antibody (NBP1-60103)

View related products by pathway.

PTMs for SLC38A3 Antibody (NBP1-60103)

Learn more about PTMs related to SLC38A3 Antibody (NBP1-60103).

Blogs on SLC38A3

There are no specific blogs for SLC38A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A3
Uniprot