Recombinant Human SLC35A1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC35A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-337 of Human SLC35A1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLC35A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
63.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC35A1 Protein

  • CDG2F
  • CMP-SA-Tr
  • CMP-sialic acid transporter
  • CMP-Sia-Tr
  • CMPST
  • CST
  • FLJ76955
  • hCST
  • mutated CMP-sialic acid transporter A1
  • solute carrier family 35 (CMP-sialic acid transporter), member 1
  • solute carrier family 35 (CMP-sialic acid transporter), member A1
  • solute carrier family 35 (UDP-galactose transporter), member 1
  • Solute carrier family 35 member A1

Background

The SLC35A1 gene encodes a CMP-sialic acid transporter located within the membrane of the Golgi apparatus. The transporter moves nucleotide sugars across the membrane for use in glycosylation reactions that take place within the Golgi department (Eckhardt et al., 1996 [PubMed 8755516]). For background information on the SLC35 family of nucleotide-sugar transporters, see SLC35A3 (MIM 605632).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69148
Species: Hu
Applications: WB
NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP1-85313
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-81770
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
MAB4727
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC35A1 Recombinant Protein (H00010559-P01) (0)

There are no publications for SLC35A1 Recombinant Protein (H00010559-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35A1 Recombinant Protein (H00010559-P01) (0)

There are no reviews for SLC35A1 Recombinant Protein (H00010559-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC35A1 Recombinant Protein (H00010559-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SLC35A1 Recombinant Protein (H00010559-P01)

Discover related pathways, diseases and genes to SLC35A1 Recombinant Protein (H00010559-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35A1 Recombinant Protein (H00010559-P01)

Discover more about diseases related to SLC35A1 Recombinant Protein (H00010559-P01).
 

Pathways for SLC35A1 Recombinant Protein (H00010559-P01)

View related products by pathway.

PTMs for SLC35A1 Recombinant Protein (H00010559-P01)

Learn more about PTMs related to SLC35A1 Recombinant Protein (H00010559-P01).

Blogs on SLC35A1

There are no specific blogs for SLC35A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NT-3 [Unconjugated]
267-N3-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC35A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35A1