Recombinant Human SLC29A4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC29A4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 283 - 345 of Human SLC29A4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC29A4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC29A4 Protein

  • ENT4PMAT
  • equilibrative nucleoside transporter 4
  • FLJ34923
  • hENT4
  • Plasma membrane monoamine transporter
  • solute carrier family 29 (nucleoside transporters), member 4
  • Solute carrier family 29 member 4

Background

SLC29A4 - solute carrier family 29 (nucleoside transporters), member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-50508
Species: Hu, Mu, Rt
Applications: WB, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-69313
Species: Hu
Applications: WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP2-31589
Species: Hu
Applications: WB, IHC, IHC-P
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84418
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-33451
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30857
Species: Hu
Applications: IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for SLC29A4 Partial Recombinant Protein (H00222962-Q01) (0)

There are no publications for SLC29A4 Partial Recombinant Protein (H00222962-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC29A4 Partial Recombinant Protein (H00222962-Q01) (0)

There are no reviews for SLC29A4 Partial Recombinant Protein (H00222962-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC29A4 Partial Recombinant Protein (H00222962-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC29A4 Products

Bioinformatics Tool for SLC29A4 Partial Recombinant Protein (H00222962-Q01)

Discover related pathways, diseases and genes to SLC29A4 Partial Recombinant Protein (H00222962-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC29A4 Partial Recombinant Protein (H00222962-Q01)

Discover more about diseases related to SLC29A4 Partial Recombinant Protein (H00222962-Q01).
 

Pathways for SLC29A4 Partial Recombinant Protein (H00222962-Q01)

View related products by pathway.

Blogs on SLC29A4

There are no specific blogs for SLC29A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141
SLC29A4 Antibody
NBP2-41314

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC29A4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC29A4