SLC28A3 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84417] - Staining of human Pancreas shows moderate membranous and cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84417] - Staining of human Duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84417] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84417] - Staining of human Prostate shows no positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC28A3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC28A3 Antibody - BSA Free (NBP1-84417) is a polyclonal antibody validated for use in IHC and WB. Anti-SLC28A3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHMEDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC28A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 25890497)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC28A3 Protein (NBP1-84417PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 26560028).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC28A3 Antibody - BSA Free

• CNT 3
• CNT3concentrative Na+-nucleoside cotransporter
• Concentrative Na(+)-nucleoside cotransporter 3
• hCNT3
• solute carrier family 28 (sodium-coupled nucleoside transporter), member 3
• solute carrier family 28 member 3

Background

Nucleoside transporters, such as SLC28A3, regulate multiple cellular processes, including neurotransmission, vasculartone, adenosine concentration in the vicinity of cell surface receptors, and transport and metabolism of nucleosidedrugs. SLC28A3 shows broad specificity for pyrimidine and purine nucleosides (Ritzel et al., 2001 (PubMed11032837)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC28A3 Antibody (NBP1-84417)(3)

Publications using NBP1-84417

• Xiaofeng Zheng, Julienne L. Carstens, Jiha Kim et al. Epithelial-to-mesenchymal transition is dispensable for metastasis but induces chemoresistance in pancreatic cancer. Nature 2015-01-01 [PMID: 26560028] (IF/IHC, Mouse)
• Skrypek N, Vasseur R, Vincent A et al. The oncogenic receptor ErbB2 modulates gemcitabine and irinotecan/SN-38 chemoresistance of human pancreatic cancer cells via hCNT1 transporter and multidrug-resistance associated protein MRP-2. Oncotarget 2015-05-10 [PMID: 25890497] (WB, Human)
• Skrypek N, Duchene B, Hebbar M et al. The MUC4 mucin mediates gemcitabine resistance of human pancreatic cancer cells via the Concentrative Nucleoside Transporter family. Oncogene 2013-03-28 [PMID: 22580602]

Bioinformatics

• Gene Symbol: SLC28A3