SLC28A3 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84417] - Staining of human pancreas shows strong membranous positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC28A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHMEDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC28A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC28A3 Protein (NBP1-84417PEP)
Publications
Read Publications using
NBP1-84417 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22580602)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC28A3 Antibody

  • CNT 3
  • CNT3concentrative Na+-nucleoside cotransporter
  • Concentrative Na(+)-nucleoside cotransporter 3
  • hCNT3
  • solute carrier family 28 (sodium-coupled nucleoside transporter), member 3
  • solute carrier family 28 member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33451
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30857
Species: Hu
Applications: IHC, IHC-P
NBP1-50508
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-69313
Species: Hu
Applications: WB
NBP2-31589
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
NBP2-41314
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-46466
Species: Hu
Applications: IHC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt

Publications for SLC28A3 Antibody (NBP1-84417)(3)

Reviews for SLC28A3 Antibody (NBP1-84417) (0)

There are no reviews for SLC28A3 Antibody (NBP1-84417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC28A3 Antibody (NBP1-84417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC28A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC28A3