SLC26A3 Antibody - BSA Free

Western Blot: SLC26A3 Antibody [NBP2-85745] - Host: Rabbit. Target Name: SLC26A3. Sample Type: HepG2. Antibody Dilution: 1.0ug/mlSLC26A3 is supported by BioGPS gene expression data to be expressed in HepG2

Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP2-85745] - Rabbit Anti-SLC26A3 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Membrane. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.

Western Blot: SLC26A3 Antibody [NBP2-85745] - WB Suggested Anti-SLC26A3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Placenta

Western Blot: SLC26A3 Antibody [NBP2-85745] - WB Suggested Anti-SLC26A3 antibody Titration: 1 ug/mL. Sample Type: Human heart

Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP2-85745] - Rabbit Anti-SLC26A3 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult liver. Observed Staining: Cytoplasmic,Nuclear. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC26A3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC26A3 Antibody - BSA Free (NBP2-85745) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC26A3. Peptide sequence: DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC26A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC26A3 Antibody - BSA Free

• chloride anion exchanger
• CLD
• congenital chloride diarrhea
• down-regulated in adenoma protein
• DRADown-regulated in adenoma
• Protein DRA
• Solute carrier family 26 member 3
• solute carrier family 26, member 3

Background

SLC26A3 is encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC26A3