SLC25A33 Antibody

Images

 
Western Blot: SLC25A33 Antibody [NBP2-13323] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: SLC25A33 Antibody [NBP2-13323] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: SLC25A33 Antibody [NBP2-13323] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A33 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A33
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC25A33 Protein (NBP2-13323PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A33 Antibody

  • BMSC-MCPPNC1 protein
  • Bone marrow stromal cell mitochondrial carrier protein
  • HuBMSC-MCP
  • MGC4399
  • mitochondrial carrier protein
  • novel mitochondrial carrier protein
  • Protein PNC1
  • solute carrier family 25 member 33
  • solute carrier family 25, member 33

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-31820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84617
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB120-5663
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-55994
Species: Hu
Applications: ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-76998
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-13323
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SLC25A33 Antibody (NBP2-13323) (0)

There are no publications for SLC25A33 Antibody (NBP2-13323).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A33 Antibody (NBP2-13323) (0)

There are no reviews for SLC25A33 Antibody (NBP2-13323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A33 Antibody (NBP2-13323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A33 Products

Bioinformatics Tool for SLC25A33 Antibody (NBP2-13323)

Discover related pathways, diseases and genes to SLC25A33 Antibody (NBP2-13323). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A33 Antibody (NBP2-13323)

Discover more about diseases related to SLC25A33 Antibody (NBP2-13323).
 

Pathways for SLC25A33 Antibody (NBP2-13323)

View related products by pathway.

PTMs for SLC25A33 Antibody (NBP2-13323)

Learn more about PTMs related to SLC25A33 Antibody (NBP2-13323).

Blogs on SLC25A33

There are no specific blogs for SLC25A33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A33 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A33