SLC25A33 Antibody

Western Blot: SLC25A33 Antibody [NBP2-13323] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate

Immunohistochemistry-Paraffin: SLC25A33 Antibody [NBP2-13323] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Western Blot: SLC25A33 Antibody [NBP2-13323] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Product Discontinued

SLC25A33 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A33
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC25A33 Antibody

• BMSC-MCPPNC1 protein
• Bone marrow stromal cell mitochondrial carrier protein
• HuBMSC-MCP
• MGC4399
• mitochondrial carrier protein
• novel mitochondrial carrier protein
• Protein PNC1
• solute carrier family 25 member 33
• solute carrier family 25, member 33

Background

SLC25A33 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 (PubMed16949250)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A33