SLC25A19 Antibody - BSA Free

Staining of human cell line HEK293 shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC25A19 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein SLC25A19 using the following amino acid sequence: PKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC25A19 Antibody - BSA Free

• DNC
• MCPHA
• mitochondrial thiamine pyrophosphate carrier
• mitochondrial uncoupling protein 1
• MUP1
• solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19
• solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19
• TPC

Background

The SLC25A19 gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochon

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A19