SLC25A15 Antibody

Images

 
Immunohistochemistry: SLC25A2 Antibody [NBP2-13320] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GTACVLTGQPFDTIKVKMQTFPDLYKGLTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC25A15 Recombinant Protein Antigen (NBP2-13320PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A15 Antibody

  • D13S327
  • mitochondrial ornithine transporter 1
  • ORC1
  • ornithine transporter 1
  • ORNT1HHH
  • solute carrier family 25 (mitochondrial carrier; ornithine transporter) member15
  • Solute carrier family 25 member 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06099
Species: Hu
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-798
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13320
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for SLC25A15 Antibody (NBP2-13320) (0)

There are no publications for SLC25A15 Antibody (NBP2-13320).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A15 Antibody (NBP2-13320) (0)

There are no reviews for SLC25A15 Antibody (NBP2-13320). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC25A15 Antibody (NBP2-13320) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A15 Products

Bioinformatics Tool for SLC25A15 Antibody (NBP2-13320)

Discover related pathways, diseases and genes to SLC25A15 Antibody (NBP2-13320). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A15 Antibody (NBP2-13320)

Discover more about diseases related to SLC25A15 Antibody (NBP2-13320).
 

Pathways for SLC25A15 Antibody (NBP2-13320)

View related products by pathway.

Blogs on SLC25A15

There are no specific blogs for SLC25A15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A15