SLC22A15 Antibody - Azide and BSA Free

Western Blot: SLC22A15 Antibody [NBP3-05043] - Analysis of extracts of various cell lines, using SLC22A15 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC22A15 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SLC22A15 Antibody - Azide and BSA Free (NBP3-05043) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 443-547 of human SLC22A15 (NP_060890.2). RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC22A15 Antibody - Azide and BSA Free

• DKFZp761G0313
• Flipt 1
• FLIPT1PRO34686
• fly-like putative organic ion transporter 1
• Fly-like putative transporter 1
• solute carrier family 22 (organic cation transporter), member 15
• solute carrier family 22 member 15
• solute carrier family 22, member 15
• trans-like protein

Background

Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC22A15