SLC22A15 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC22A15 Antibody [NBP1-84662] - Staining of human heart muscle shows strong membranous positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: SLC22A15 Antibody [NBP1-84662] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Immunohistochemistry-Paraffin: SLC22A15 Antibody [NBP1-84662] - Staining of human lung shows strong membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: SLC22A15 Antibody [NBP1-84662] - Staining of human cerebral cortex shows strong membranous positivity in endothelial cells.

Immunohistochemistry-Paraffin: SLC22A15 Antibody [NBP1-84662] - Staining of human kidney shows strong membranous positivity in endothelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC22A15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC22A15 Antibody - BSA Free (NBP1-84662) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
• Predicted Species: Mouse (94%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC22A15 Protein (NBP1-84662PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 0)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC22A15 Antibody - BSA Free

• DKFZp761G0313
• Flipt 1
• FLIPT1PRO34686
• fly-like putative organic ion transporter 1
• Fly-like putative transporter 1
• solute carrier family 22 (organic cation transporter), member 15
• solute carrier family 22 member 15
• solute carrier family 22, member 15
• trans-like protein

Background

Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC22A15 Antibody (NBP1-84662)(1)

Publication using NBP1-84662

• Gry M, Oksvold P, Ponten F et al. Tissue specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010-01-01

Bioinformatics

• Gene Symbol: SLC22A15