SLC22A15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC22A15 Antibody [NBP1-84662] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC22A15 Antibody [NBP1-84662] - Staining of human cerebral cortex shows strong cytoplasmic positivity in endothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC22A15 Protein (NBP1-84662PEP)
Publications
Read Publication using NBP1-84662.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 0)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A15 Antibody

  • DKFZp761G0313
  • Flipt 1
  • FLIPT1PRO34686
  • fly-like putative organic ion transporter 1
  • Fly-like putative transporter 1
  • solute carrier family 22 (organic cation transporter), member 15
  • solute carrier family 22 member 15
  • solute carrier family 22, member 15
  • trans-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-05754
Species: Hu
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-04309
Species: Hu
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-69536
Species: Hu
Applications: WB
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-91568
Species: Hu
Applications: WB
NBP1-84662
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SLC22A15 Antibody (NBP1-84662)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-84662 Applications Species
Gry M, Oksvold P, Ponten F et al. Tissue specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010

Reviews for SLC22A15 Antibody (NBP1-84662) (0)

There are no reviews for SLC22A15 Antibody (NBP1-84662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC22A15 Antibody (NBP1-84662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A15 Products

Bioinformatics Tool for SLC22A15 Antibody (NBP1-84662)

Discover related pathways, diseases and genes to SLC22A15 Antibody (NBP1-84662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A15 Antibody (NBP1-84662)

Discover more about diseases related to SLC22A15 Antibody (NBP1-84662).
 

Pathways for SLC22A15 Antibody (NBP1-84662)

View related products by pathway.

Blogs on SLC22A15

There are no specific blogs for SLC22A15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A15