SLC22A15 Antibody


Immunocytochemistry/ Immunofluorescence: SLC22A15 Antibody [NBP1-84662] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC22A15 Antibody [NBP1-84662] - Staining of human cerebral cortex shows strong cytoplasmic positivity in endothelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SLC22A15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
Specificity of human SLC22A15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC22A15 Protein (NBP1-84662PEP)
Read Publication using NBP1-84662.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 0)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC22A15 Antibody

  • DKFZp761G0313
  • Flipt 1
  • FLIPT1PRO34686
  • fly-like putative organic ion transporter 1
  • Fly-like putative transporter 1
  • solute carrier family 22 (organic cation transporter), member 15
  • solute carrier family 22 member 15
  • solute carrier family 22, member 15
  • trans-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu
Applications: IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SLC22A15 Antibody (NBP1-84662)(1)

Showing Publication 1 - 1 of 1.
Publication using NBP1-84662 Applications Species
Gry M, Oksvold P, Ponten F et al. Tissue specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010

Reviews for SLC22A15 Antibody (NBP1-84662) (0)

There are no reviews for SLC22A15 Antibody (NBP1-84662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC22A15 Antibody (NBP1-84662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC22A15 Products

Bioinformatics Tool for SLC22A15 Antibody (NBP1-84662)

Discover related pathways, diseases and genes to SLC22A15 Antibody (NBP1-84662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A15 Antibody (NBP1-84662)

Discover more about diseases related to SLC22A15 Antibody (NBP1-84662).

Pathways for SLC22A15 Antibody (NBP1-84662)

View related products by pathway.

Blogs on SLC22A15

There are no specific blogs for SLC22A15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC22A15 Antibody and receive a gift card or discount.


Gene Symbol SLC22A15